Sequence:
download
OVP08121sequence.fasta
>Ovo-ZYG-12 MFFRVDPSQKRCIRLNFLFKIYCFGTITTLFFSDPLFFNDNWLSNIPRYDQSTNWRVKANNLRKVYRRVSDYYTDQLGAE LTREWLIDISGIAESSDSEQLCRLLQLVLGAALLCTNNEKFIRLLLDQDESVQRTAMNIMREIKELVPEPLEEKTEVIDT SIIFLNRSSEPMESKEQMINLKIKVESLKQECTQLNEKLKEARTEKEALSSDNESLRLRVDELSEGSIVEMESLRKQIRS LRSVCENTQDTLYKAEAERDHLKKINQQLLDENVELRTKIQDMEPLEVEFKRLKDELEEHRLLVQKYEKLDSQIVGYKAK LEEWKAQKTEVKVLEDKVATYMKSVIALEDEQRKNGVLKTQIESLLLENLELGTKLNDEIRRADKSEFECSQLSERINEI EKEKEYLRQERHELSEQLLLNENSSNAPSLHDETNDVNSTAFLRERIIRLEAEKERLLAGNMTDDEKLGLKEELNSLTVQ KRNLETELKIAQNKTNELEKRLENLNAIVESGNFVNSDRLTEEQTANERMAIQIEQLKARLKQATHDLEQQVADKKALSD ELTSSKQQVKNEKERLTHYMEKARRMFEDLEEQNRAVEGGALSRHEFDSIRRERDAYKQNIETLKESHERSRTMQEEEQR LFTTHAYYMMMQLQQQNSSVRENSDEKSFLTRQRQCSSFNIMSDIFAESKAQLEDEKEIFDFHNCFFHAYDLVFSLLAAV LCLMLALAFFSKNSASFYSEVSFIGPPPT
view sequence (749 aa)
>Ovo-ZYG-12
MFFRVDPSQKRCIRLNFLFKIYCFGTITTLFFSDPLFFNDNWLSNIPRYDQSTNWRVKANNLRKVYRRVSDYYTDQLGAE
LTREWLIDISGIAESSDSEQLCRLLQLVLGAALLCTNNEKFIRLLLDQDESVQRTAMNIMREIKELVPEPLEEKTEVIDT
SIIFLNRSSEPMESKEQMINLKIKVESLKQECTQLNEKLKEARTEKEALSSDNESLRLRVDELSEGSIVEMESLRKQIRS
LRSVCENTQDTLYKAEAERDHLKKINQQLLDENVELRTKIQDMEPLEVEFKRLKDELEEHRLLVQKYEKLDSQIVGYKAK
LEEWKAQKTEVKVLEDKVATYMKSVIALEDEQRKNGVLKTQIESLLLENLELGTKLNDEIRRADKSEFECSQLSERINEI
EKEKEYLRQERHELSEQLLLNENSSNAPSLHDETNDVNSTAFLRERIIRLEAEKERLLAGNMTDDEKLGLKEELNSLTVQ
KRNLETELKIAQNKTNELEKRLENLNAIVESGNFVNSDRLTEEQTANERMAIQIEQLKARLKQATHDLEQQVADKKALSD
ELTSSKQQVKNEKERLTHYMEKARRMFEDLEEQNRAVEGGALSRHEFDSIRRERDAYKQNIETLKESHERSRTMQEEEQR
LFTTHAYYMMMQLQQQNSSVRENSDEKSFLTRQRQCSSFNIMSDIFAESKAQLEDEKEIFDFHNCFFHAYDLVFSLLAAV
LCLMLALAFFSKNSASFYSEVSFIGPPPT
Estimated Isoelectric Point:
5.13234710693359
Estimated Molecular Weight:
87.8 kD
Amino Acid Composition:
Amino Acid Frequency
Thr36
Lys57
Gln44
Leu94
Gly14
Met18
Ser58
Tyr16
His11
Glu101
Arg53
Cys10
Phe30
Pro11
Val32
Asn44
Ala40
Ile37
Trp4
Asp39