Sequence:
download
OVP07793sequence.fasta
>Ovo-DCS-1 MDVSMAVDGDQNNGNDTEELINMETFKFKEILAEDGSRKTAFVLLDVNDCSNQAILIVERTPFPVDKQDWNEIVSQCSLK TLSTNDIYSNHVLFPPKKFAGTIIFSSFSSLTTLINPCTEKHIAKYRDQKRYVIHETPDDYKSITLPHLEEHQFTLKWIF NLLEHKAEVDRIIFDDVDPHNGFVLAPDLKWDGENLANLYILAIIRRKGIKSIRDLTANDLPLLENICQKSYMAIKEKYG IDKHQIRAYFHYQPSFYHLHVHFIHVSYDAPASGVAMAYLLEDVINNIKLIPDYYQRSTLTFILKENNPLLKLYRDTYQW
view sequence (320 aa)
>Ovo-DCS-1
MDVSMAVDGDQNNGNDTEELINMETFKFKEILAEDGSRKTAFVLLDVNDCSNQAILIVERTPFPVDKQDWNEIVSQCSLK
TLSTNDIYSNHVLFPPKKFAGTIIFSSFSSLTTLINPCTEKHIAKYRDQKRYVIHETPDDYKSITLPHLEEHQFTLKWIF
NLLEHKAEVDRIIFDDVDPHNGFVLAPDLKWDGENLANLYILAIIRRKGIKSIRDLTANDLPLLENICQKSYMAIKEKYG
IDKHQIRAYFHYQPSFYHLHVHFIHVSYDAPASGVAMAYLLEDVINNIKLIPDYYQRSTLTFILKENNPLLKLYRDTYQW
Estimated Isoelectric Point:
5.70079803466797
Estimated Molecular Weight:
37.2 kD
Amino Acid Composition:
Amino Acid Frequency
Thr17
Lys23
Gln11
Leu33
Gly9
Met5
Ser18
Tyr16
His13
Glu18
Arg11
Cys4
Phe16
Pro14
Val16
Asn20
Ala17
Ile29
Trp4
Asp26