Sequence:
download
OVP07580sequence.fasta
>Ovo-MAB-20 MLLSFEVLFIHIFLLLIPFFETTTLSTIFPENVFTAGRLAYRRLLVDPQSASLYVGANGHLFRLWAYNINITASTDGLYA HVELPVSQADAEECRRAGHAECTNGVRLMFLKEGHQTLLICSSNAMKPQLRELDALSLQERSSPENVIGVCSAHVDLNTT AVLVEWGNPEDIPAIYSGIRTGLILDNNLIYRPPLVKNNKEVYSSMRTIYTDSKWLYEPDFVASFDIDRYVYFFFRELAI ERENCERTVFSRVARICKKDIGGKNVLRQVWTTFVKARLNCSTSSKFPIYFNEIHSLQSVNGRSDTFFYATFATPEISFG GSAVCIFSLNSINQLFDDGYFLEQTSSDGNWITTPIENVPEHRPGTCTSNSASVPDSSLHFARSHLLMADAVSASPPLLT LRNELLTHIAVDPMEDVNVIFVYSHSSQRLHKVAHWFKEADRHSKLLATYTLKNTGTVFAMTLLSGEFLYLSSEDNVAQY FLAQCSLHTTCAQCAVDPYCSWNTARELCYKRDQARLSTVGWISSNSKDVTNCLGHIRRMTINAYTGDTLHLTCVSQSSW TFNAEPISPSEKRQLTTEGGLVVFNVSRIDSGAYECNVDGEGVMIYDVTVDDAECAQPTSVTQFKSKYREWCQKLAKYKY SAEKWQLWYDRNAANCPKQRITDFNHISTE
view sequence (670 aa)
>Ovo-MAB-20
MLLSFEVLFIHIFLLLIPFFETTTLSTIFPENVFTAGRLAYRRLLVDPQSASLYVGANGHLFRLWAYNINITASTDGLYA
HVELPVSQADAEECRRAGHAECTNGVRLMFLKEGHQTLLICSSNAMKPQLRELDALSLQERSSPENVIGVCSAHVDLNTT
AVLVEWGNPEDIPAIYSGIRTGLILDNNLIYRPPLVKNNKEVYSSMRTIYTDSKWLYEPDFVASFDIDRYVYFFFRELAI
ERENCERTVFSRVARICKKDIGGKNVLRQVWTTFVKARLNCSTSSKFPIYFNEIHSLQSVNGRSDTFFYATFATPEISFG
GSAVCIFSLNSINQLFDDGYFLEQTSSDGNWITTPIENVPEHRPGTCTSNSASVPDSSLHFARSHLLMADAVSASPPLLT
LRNELLTHIAVDPMEDVNVIFVYSHSSQRLHKVAHWFKEADRHSKLLATYTLKNTGTVFAMTLLSGEFLYLSSEDNVAQY
FLAQCSLHTTCAQCAVDPYCSWNTARELCYKRDQARLSTVGWISSNSKDVTNCLGHIRRMTINAYTGDTLHLTCVSQSSW
TFNAEPISPSEKRQLTTEGGLVVFNVSRIDSGAYECNVDGEGVMIYDVTVDDAECAQPTSVTQFKSKYREWCQKLAKYKY
SAEKWQLWYDRNAANCPKQRITDFNHISTE
Estimated Isoelectric Point:
5.90523529052734
Estimated Molecular Weight:
75.7 kD
Amino Acid Composition:
Amino Acid Frequency
Thr50
Lys24
Gln21
Leu64
Gly29
Met9
Ser62
Tyr27
His19
Glu39
Arg36
Cys20
Phe35
Pro25
Val45
Asn37
Ala48
Ile35
Trp12
Asp33