Sequence:
download
OVP05732sequence.fasta
>Ovo-LEV-10 MLLSVILPIIFTWCNADDNDKGRDVEIVFQCDHIFDSSTTEGEFQLPMLPPPATISEQISRPEGPKNLQCIYTFVAAPKQ RVKLNFDQFHLAGTTGNCETEYVDIYSELEGPDDDLLSASFGGRYCGSVSPYVRISLNRVIVLVFHSRAASNQRNGLKFR GHYAFISDAPYQVGEKIPPGKCDFVIDSKLRKRGSILSPTYPGTYPKNFRCTYLLNGRTNQRIRLLFRDFDIYFGGEHCP YDSLTVYDGPNNKHPIIRKLCGLQQRMVIYSFGPSAFIEFNTTSPAKADPRGYSLDYEFSNRYVDVLKMMDNQLGITHLR GSECDLLVRSNRETTHFIHSPKYPLMYPANTTCTFIIDGLQGEQNLEEVILTFEKFAVLSETIDRPSSANYDDDDDDDDD EPCATSYVGIAFVPASIKSVLSSGEESNYDAVICDRIKDGSPVLGPYISDGPRMVLVFNSNEKISKGDGQEPLGFKAKIQ FKTDFGIPGKPVGDSNQCMFQFTKPRGWFNSPRYPVNYPLDTNCTYIIKAKPDEQIQVYFEQFALYFDEHSSVETSCADF LEISDVFVKNGVETLQLQARYCANTFPGPTVTAFGSHELRVFFLSNHEGTGNGFKAIYQIRKAFAEEIPTKAAARHCGQR ITRTDDLTSGWFVSPGYPIKYNKDLICDWEITVRPNHQILLHLVKMEIEGSMTAESVNCQNAVIRVDTERGVGAGPAVQE ICGTDESIIQPIISKNNTVRIRFFTSPDKVNGLKGFNFTWTEVKKITEDSECSDPSMHLCTYTKLCIDARLKCNGDENCG LHDDTDEANCSKLENAADIRMVFFLATFSGFIFLFISGFAAYVFKKKFEKKKDKRRRRAKFGMKHQRKPFRNPRPITKAD PHLLPSPAASRLTHHNVTADIIPLSINQRNDKPPNGETSTSKNNASLIHSSKSIDDNNIFYG
view sequence (942 aa)
>Ovo-LEV-10
MLLSVILPIIFTWCNADDNDKGRDVEIVFQCDHIFDSSTTEGEFQLPMLPPPATISEQISRPEGPKNLQCIYTFVAAPKQ
RVKLNFDQFHLAGTTGNCETEYVDIYSELEGPDDDLLSASFGGRYCGSVSPYVRISLNRVIVLVFHSRAASNQRNGLKFR
GHYAFISDAPYQVGEKIPPGKCDFVIDSKLRKRGSILSPTYPGTYPKNFRCTYLLNGRTNQRIRLLFRDFDIYFGGEHCP
YDSLTVYDGPNNKHPIIRKLCGLQQRMVIYSFGPSAFIEFNTTSPAKADPRGYSLDYEFSNRYVDVLKMMDNQLGITHLR
GSECDLLVRSNRETTHFIHSPKYPLMYPANTTCTFIIDGLQGEQNLEEVILTFEKFAVLSETIDRPSSANYDDDDDDDDD
EPCATSYVGIAFVPASIKSVLSSGEESNYDAVICDRIKDGSPVLGPYISDGPRMVLVFNSNEKISKGDGQEPLGFKAKIQ
FKTDFGIPGKPVGDSNQCMFQFTKPRGWFNSPRYPVNYPLDTNCTYIIKAKPDEQIQVYFEQFALYFDEHSSVETSCADF
LEISDVFVKNGVETLQLQARYCANTFPGPTVTAFGSHELRVFFLSNHEGTGNGFKAIYQIRKAFAEEIPTKAAARHCGQR
ITRTDDLTSGWFVSPGYPIKYNKDLICDWEITVRPNHQILLHLVKMEIEGSMTAESVNCQNAVIRVDTERGVGAGPAVQE
ICGTDESIIQPIISKNNTVRIRFFTSPDKVNGLKGFNFTWTEVKKITEDSECSDPSMHLCTYTKLCIDARLKCNGDENCG
LHDDTDEANCSKLENAADIRMVFFLATFSGFIFLFISGFAAYVFKKKFEKKKDKRRRRAKFGMKHQRKPFRNPRPITKAD
PHLLPSPAASRLTHHNVTADIIPLSINQRNDKPPNGETSTSKNNASLIHSSKSIDDNNIFYG
Estimated Isoelectric Point:
6.10134124755859
Estimated Molecular Weight:
106.0 kD
Amino Acid Composition:
Amino Acid Frequency
Thr56
Lys56
Gln31
Leu63
Gly61
Met13
Ser69
Tyr35
His22
Glu50
Arg50
Cys27
Phe60
Pro58
Val50
Asn52
Ala50
Ile67
Trp5
Asp67