Sequence:
download
OVP04476sequence.fasta
>Ovo-SUP-12 MIPSIYGQLASTGTIADPLVQAAAAALAAQSAAAAATASATDTLSTTGIRDTTFTKIFVGGLPYHTSDKTLHEYFEQFGE IEEAVVITDRQTQKSRGYGFVTMKDRAAAERACKDPNPIIDGRKANVNLAYLGAKPRGNIQLAALSNGLQQIPLQTQLQA LFPGRIAGLPQLLYPTAAAAAAAATNPLMNTLNGLQNTTSLAGAGQVNTSQTQQQYIDYATLAAVAAAGGAAATAAQNPF SLHPAVSAAGTVGLEQYAYMPYGLIPANNYAAQLTAAQSQLAAVTQQQAALEHQRV
view sequence (296 aa)
>Ovo-SUP-12
MIPSIYGQLASTGTIADPLVQAAAAALAAQSAAAAATASATDTLSTTGIRDTTFTKIFVGGLPYHTSDKTLHEYFEQFGE
IEEAVVITDRQTQKSRGYGFVTMKDRAAAERACKDPNPIIDGRKANVNLAYLGAKPRGNIQLAALSNGLQQIPLQTQLQA
LFPGRIAGLPQLLYPTAAAAAAAATNPLMNTLNGLQNTTSLAGAGQVNTSQTQQQYIDYATLAAVAAAGGAAATAAQNPF
SLHPAVSAAGTVGLEQYAYMPYGLIPANNYAAQLTAAQSQLAAVTQQQAALEHQRV
Estimated Isoelectric Point:
6.40959930419922
Estimated Molecular Weight:
30.6 kD
Amino Acid Composition:
Amino Acid Frequency
Thr28
Lys7
Gln28
Leu28
Gly22
Met4
Ser13
Tyr12
His4
Glu8
Arg9
Cys1
Phe7
Pro15
Val12
Asn13
Ala62
Ile14
Asp9