Sequence:
download
OVP03647sequence.fasta
>Ovo-RHEB-1 MANAIQRKIAVMGYPCVGKSSITLRFVYGNFPDAYDTTIEDIYTKPYKFNGKQFALQITDTAGQQEFSLFPRSCAIDIDG YILVYAIDDRKSFEIVQSIYDKIMENLGDKNIPIVVVGNKLDLHFNARHVSTEEGRQLAISWNAAFLETSAKDNTSVEQI FDCLLREIEIANGNMKRNQNGCVIS
view sequence (185 aa)
>Ovo-RHEB-1
MANAIQRKIAVMGYPCVGKSSITLRFVYGNFPDAYDTTIEDIYTKPYKFNGKQFALQITDTAGQQEFSLFPRSCAIDIDG
YILVYAIDDRKSFEIVQSIYDKIMENLGDKNIPIVVVGNKLDLHFNARHVSTEEGRQLAISWNAAFLETSAKDNTSVEQI
FDCLLREIEIANGNMKRNQNGCVIS
Estimated Isoelectric Point:
5.21672821044922
Estimated Molecular Weight:
20.8 kD
Amino Acid Composition:
Amino Acid Frequency
Thr9
Lys11
Gln9
Leu11
Gly11
Met4
Ser11
Tyr8
His2
Glu10
Arg8
Cys4
Phe10
Pro5
Val11
Asn13
Ala14
Ile20
Trp1
Asp13