Sequence:
download
OVP03065sequence.fasta
>Ovo-RNP-3 MFYQFFGVIRFLPGSDYGSLGSYLENEEKRAYFFEIIVIWLVSDLFAMDVKPNHTIYINNLNEKTKKEELKKALYAIFSQ FGQIIDIMAFKTLKMRGQAHVIFKEISSATNALRAMQGFPFYDKPMLIKSGTPEYLNSLQRIQFAREDSDVIAKAKGTYI DRPKKHLLAKQSAGEKRKKSGHVKESKKMRMDKAPTGKTEVPEKANPPNKILFCTNLPEETTEQMLSLLFNPYPGLKDIR RIPNRPDIAFVEFETEAEATSARAGLNNFKITPSQSIKIRKECARALDCWKCHKAIDCLKEKFFCPMCSAIQPTEDKNYF DYLGLLPDFDVDLSLLKINFLKLQSVVHPDKFSKCSQEEKKISENCSRYLNEAYKTLIEPLERAKYLLTLKGESLDNEDV IDSTDFLVEMMELNELVVTNNDPKELKILLNEVETKINMLGKEFKNSIETNELRKAKEAVLKLTFYYRLKASLSSKIADN E
view sequence (481 aa)
>Ovo-RNP-3
MFYQFFGVIRFLPGSDYGSLGSYLENEEKRAYFFEIIVIWLVSDLFAMDVKPNHTIYINNLNEKTKKEELKKALYAIFSQ
FGQIIDIMAFKTLKMRGQAHVIFKEISSATNALRAMQGFPFYDKPMLIKSGTPEYLNSLQRIQFAREDSDVIAKAKGTYI
DRPKKHLLAKQSAGEKRKKSGHVKESKKMRMDKAPTGKTEVPEKANPPNKILFCTNLPEETTEQMLSLLFNPYPGLKDIR
RIPNRPDIAFVEFETEAEATSARAGLNNFKITPSQSIKIRKECARALDCWKCHKAIDCLKEKFFCPMCSAIQPTEDKNYF
DYLGLLPDFDVDLSLLKINFLKLQSVVHPDKFSKCSQEEKKISENCSRYLNEAYKTLIEPLERAKYLLTLKGESLDNEDV
IDSTDFLVEMMELNELVVTNNDPKELKILLNEVETKINMLGKEFKNSIETNELRKAKEAVLKLTFYYRLKASLSSKIADN
E
Estimated Isoelectric Point:
8.57210540771484
Estimated Molecular Weight:
55.4 kD
Amino Acid Composition:
Amino Acid Frequency
Thr22
Lys55
Gln13
Leu51
Gly17
Met13
Ser30
Tyr17
His6
Glu43
Arg19
Cys9
Phe28
Pro22
Val18
Asn27
Ala31
Ile33
Trp2
Asp25