Sequence:
download
OVP03049sequence.fasta
>Ovo-MOG-4 MATFLEQWVNDELYKLVGCSNHTAVQFILALARKSTDAGNLLERLRNTDTMEDTPAVRKFASELIARVPHAAVKTEKIIR PSAAELHAKEIMRLNRSLKTIESDDEENIPSKKRKENKKAKNKLLVKESASDEMDRINAEEEQDLRERDELAARIRQRDK EKTRNIVTKSEKKAAEEAAKRLKLETKDRTEIVSQLREESRKQYLSKRKDDKLDELEKIVEDDKHFFADERLTEREKSEM KYRKDILEYARQHERAADFLKIKRYHVPDAKVKSIPVDSLEDADEIPKGDGKRWEDDRLAAAITKYGAKDKKRNEFDMVL DDEKIDFIQAFQMPGTSDTEGEVISVAQKKKLTLAETRKSLPVYTYRDEFIQAVHDHQVLIIEGETGSGKTTQLPQYLYE SGFCANKMKVGCTQPRRVAAMSVATRVAEEMGVKLGIEVGYSIRFEDCTSEKTVIKYMTDGMLLREFLNEPDLASYSVII IDEAHERTLHTDVLFGLVKDIARFRKDLKLLISSATLDVEKFSTFFDDAPILRIPGRRFPVDIYYTKAPEADYLDAAMVS ILQIHLTQPLPGDILVFLTGQDEIETLMESLLERTKYFGKKIKELIILPIYANLPTDLQAKIFEPTPPNARKVVLATNIA ETSVTIDGICYVIDPGFNKQNSFDARSGVEHLHVVTISKAAANQRAGRAGRTGPGKCFRLYTAWAYKNELEDQPIPEIQR TNLGNVVLMLKSLGIHDLVHFDYLDPPPQETLVIALEQLYALGALNHRGELTKLGRRMAEFPCDPCMSKMIIASEKYGCS EEIITIAGMLSCNAAVFYRPKALVIHADAARKGFWVPGGDHLTLLNVYNRWRDTNYSSQWCMENFIQHRTMKKARDVRDQ FESLLERVEIDQVSNNDSVAIRKTVTAGYFYNCAKLDSSGHYKTVKHKHTVHIHPNSSLFEETPRWMIYFELVFTSKEFM REVIEIESGWLMEVAPHYYKAKELEDSVNRKMPKQKGKTAIELSSL
view sequence (1006 aa)
>Ovo-MOG-4
MATFLEQWVNDELYKLVGCSNHTAVQFILALARKSTDAGNLLERLRNTDTMEDTPAVRKFASELIARVPHAAVKTEKIIR
PSAAELHAKEIMRLNRSLKTIESDDEENIPSKKRKENKKAKNKLLVKESASDEMDRINAEEEQDLRERDELAARIRQRDK
EKTRNIVTKSEKKAAEEAAKRLKLETKDRTEIVSQLREESRKQYLSKRKDDKLDELEKIVEDDKHFFADERLTEREKSEM
KYRKDILEYARQHERAADFLKIKRYHVPDAKVKSIPVDSLEDADEIPKGDGKRWEDDRLAAAITKYGAKDKKRNEFDMVL
DDEKIDFIQAFQMPGTSDTEGEVISVAQKKKLTLAETRKSLPVYTYRDEFIQAVHDHQVLIIEGETGSGKTTQLPQYLYE
SGFCANKMKVGCTQPRRVAAMSVATRVAEEMGVKLGIEVGYSIRFEDCTSEKTVIKYMTDGMLLREFLNEPDLASYSVII
IDEAHERTLHTDVLFGLVKDIARFRKDLKLLISSATLDVEKFSTFFDDAPILRIPGRRFPVDIYYTKAPEADYLDAAMVS
ILQIHLTQPLPGDILVFLTGQDEIETLMESLLERTKYFGKKIKELIILPIYANLPTDLQAKIFEPTPPNARKVVLATNIA
ETSVTIDGICYVIDPGFNKQNSFDARSGVEHLHVVTISKAAANQRAGRAGRTGPGKCFRLYTAWAYKNELEDQPIPEIQR
TNLGNVVLMLKSLGIHDLVHFDYLDPPPQETLVIALEQLYALGALNHRGELTKLGRRMAEFPCDPCMSKMIIASEKYGCS
EEIITIAGMLSCNAAVFYRPKALVIHADAARKGFWVPGGDHLTLLNVYNRWRDTNYSSQWCMENFIQHRTMKKARDVRDQ
FESLLERVEIDQVSNNDSVAIRKTVTAGYFYNCAKLDSSGHYKTVKHKHTVHIHPNSSLFEETPRWMIYFELVFTSKEFM
REVIEIESGWLMEVAPHYYKAKELEDSVNRKMPKQKGKTAIELSSL
Estimated Isoelectric Point:
6.54161834716797
Estimated Molecular Weight:
115.1 kD
Amino Acid Composition:
Amino Acid Frequency
Thr58
Lys88
Gln30
Leu91
Gly42
Met25
Ser54
Tyr33
His25
Glu92
Arg66
Cys12
Phe36
Pro38
Val59
Asn33
Ala82
Ile66
Trp8
Asp68