Sequence:
download
OVP02488sequence.fasta
>Ovo-ITR-1 MLLSQHHLYNNSRAMSIDAFHNTSLHIGDVISLYAKDRYRPVEDRLEERLSPRTGFLSTLGLVDDRCIVEIGNGTPDSPP KKFRDCLFRICSVNRYAAQKQFWTEQKKFQTGESLFEEDMLKKLKHAADKEKEQNDMEYKKMLGVNVQYGGTIQLLHVKS NKYLTVLKNSPAKLERNAMKVYLDKNGNEGSWFHVEPVYKHSFLGDNVNAGDRISLVPYSYAPISTTTGHIKPQLHLSHL SLPDHPIGFEVNCSNELTEWQVLMFLQFDENQENIVKSGDVVRLFHAEQQTFLTLDTIPKKNLDIVFLRLTNRPSAADAT SSRALWEIQVVQIDSYRGAAASWHEKFRFKHLATDMYLSVEWMELNKAENATNEITYSHSSSPANMEAGCSGDGQYYLMD VRISQRTYVRLLHLRTNTWIHTTDPVEKQNLYHFSKNEKGWVKVVSGNFKIDKETFALLPVRPDEVRDLDFANDACKALH GFVKLIESGQIISKEPMNVTIQLLTECIYFVTDQSNHMTDPIKIVDFKPPRDRQKLLREQGVLDQIFALLRVPFLSRNGN DPEPLLSSPHKLSEQGNQIFKRIFRLCYSLLRYSQVGYRKNQEYLAEKFGQIQEQIGFDLLAEDTMTAVLHNNPKLLEKY VKNPHVERFVELVRENKAGRFLDYLADLCVCRGEANKKIQELICSCVLNETNRDIFISTIIYDKSSDEVWICWSNSFCKK LVSVTMDAAKGQTEDIEVLDYYKHQLDLLAQMCHNQQYLAIDPPPERRLLNLSLELPADLVLKCVSDTRLPQDLRASFTR LMLHLHVIRGSPLNAVHHARLWREIPLHVTISGNSSRSVNGYVDGSHIHTEGEVFDKLLKTVDVYLEELCKTTREGEPVL DPSASKLEQNRLTFEIVTLARALAHFGFYSFADLLHLAQNLLIIADSSPKKPGAKMSFDKTALFRQVTYSVIGVNALQKG AKQYLSHMEAETCTENSLLAKESKQMILQTKLIIVEILNFIMDVRRDYRITVALSWFKQRFPCDEFGELLSRADLSEHEA SQLHKEVFQVGEEKLDFDGKNGQLVLRILLQMTITDFSKLTSTALTVLFRHFTQYQEFVEDLKQVQLLVSNDDVENYQQI DRDLFILKILTEKSELWVQSDKTRSGSSSSPSFDEHTSSPDDSSKPSLAVQTTSQQLKDYGLNASCAFHNDESFRSLVET IEQHYFSSRDECIKLLCELLLGDDRAEASSALYELSDRAPFISYPLLRQILYRVKQLCYKNEKPDKMNQQLLRNMRVHKY VLKFLSVPYDKKNDVEMPRLITLSHEFLRSFCRNNVENQFRLYKHISIEQNAKEGCLSVNTVEEVATLTAIFKNNRILCE NVSEELIAHIINMIEHKARSAVYIEFLQTVVMVQEKEIKSAQEKVAEEICSSSDDVRVFYADSASFEQLKQLMQNTGPEE LNADHPLRYHIDLVRLLALCTRGRNNTTELKCASQLSMDHIVRVLTSPYCLIQVKEVYLQFMLHCYIDADAEMKDIDNID FIEKILKNILRDIQVYLGTLLELKTEKSTFLPNSALEKYICHTVTEVLIKLFERSSTHKLIMEIPEHRQSFSKMIQSLNQ LQEELTRKNFTKNYYRVAECIRRLSRCAEENAVMLPVNGCMPSASAETTAKQHWQSAFNSVRFISQANKRTKTRLNVPDY VQIAESFSDVVSCYEAMVAEFKMFALPLQAAETSVLVDVFHAPERLFTPGSDLYQECENGGVIAKLIQHCKSLLQHEQKT LCVRVLQTLCRMASNAKCNFINQAEEVRIRLLKRYFGDDAVFSVKTNEQTTKLEGNGIPKILPYSLCMHSYFRFTFSECE FGHELKPIKELSLYDVQCKLNSAGASDLIIDLIMREPSHEVFLMTIQLSKALLHEGNYEVQMSFYNRLKEQNTSEPFFNA LKTKLQVAQNRLKSDMMACNDSRQRHSVSNSVSGRSSVMNSPSPEDSTYTLKELKSVDINSIDLTVSLSAVPDGYFPGLF DPDVNLNFWDDKKTLLSQEVALIEPILRFLQLLCENHNLMLQNFLRYQGSRQNHNLVDETLMFLDVICGSTKGCLGVFGE IGEHNSSLITQTLVTLTEFCQGPCNENQNTVGSHESGLNMIISLVLNEIKPLCLTHMDLALEIKAKISAASKLLLAVMES RRDADNAERILMNMDHMDTGAKQLVQAIKVAYGMSELNEFTTSKITKNYETGCSLIKMKPRISRPDIAIQDGFITSYPST NITLVNPQEVGHNIFILATQLSRYNETLREALNPENNKDELTSKALRYYKQYTAQIEIVRSDRKMERVIFPIHAICEYLT PESKLNILLETEQDAQGSKVTEFFGQWPKLFEEMKWQKKLQDRKYFSNCTKRLILWARISFFFAILVNTVIAISYPFSGN SRQEIISPSNPFLYVFPMVSLLFLRTQWSEKASLGRTNEIYWAFAGIMSSFTILFITVIGVVLTLSVIGLLQLINKSVHI VSYIGNRGLIDKTWRERLQDKGIWYHLAYLLICIQGLFVHPLFYALLLFDIVASEETLRNVIRSVTRNWRSIIMTGLLAV ILVYLFSIIGYLYFQKDFQLEVDELDDSEKDNVAAENLPSMECIHLQSSIFRQYINQNMCSEMKNSRSNQPIDDKGELKV WSCQTLRMCILTTLNWGLRNGGGIGDVLRNVAPHEESFLSRIIYDMTFFIVIIVIVLNLVFGVIIDTFGDLRAERNEKVD QLRNNCFICGLERGRFDNKIVTFEEHRKNEHNLYHYLYFIVWLQIKDETEFTGPESYEHKSDWFPRMQAMSLAEDNQEVE QTDDINEIHDSIDKLLDVVKKQGRQLEELKQVMDISRNILRTKLPDIKLHGACQHLINSRRFIIKSLYML
view sequence (2870 aa)
>Ovo-ITR-1
MLLSQHHLYNNSRAMSIDAFHNTSLHIGDVISLYAKDRYRPVEDRLEERLSPRTGFLSTLGLVDDRCIVEIGNGTPDSPP
KKFRDCLFRICSVNRYAAQKQFWTEQKKFQTGESLFEEDMLKKLKHAADKEKEQNDMEYKKMLGVNVQYGGTIQLLHVKS
NKYLTVLKNSPAKLERNAMKVYLDKNGNEGSWFHVEPVYKHSFLGDNVNAGDRISLVPYSYAPISTTTGHIKPQLHLSHL
SLPDHPIGFEVNCSNELTEWQVLMFLQFDENQENIVKSGDVVRLFHAEQQTFLTLDTIPKKNLDIVFLRLTNRPSAADAT
SSRALWEIQVVQIDSYRGAAASWHEKFRFKHLATDMYLSVEWMELNKAENATNEITYSHSSSPANMEAGCSGDGQYYLMD
VRISQRTYVRLLHLRTNTWIHTTDPVEKQNLYHFSKNEKGWVKVVSGNFKIDKETFALLPVRPDEVRDLDFANDACKALH
GFVKLIESGQIISKEPMNVTIQLLTECIYFVTDQSNHMTDPIKIVDFKPPRDRQKLLREQGVLDQIFALLRVPFLSRNGN
DPEPLLSSPHKLSEQGNQIFKRIFRLCYSLLRYSQVGYRKNQEYLAEKFGQIQEQIGFDLLAEDTMTAVLHNNPKLLEKY
VKNPHVERFVELVRENKAGRFLDYLADLCVCRGEANKKIQELICSCVLNETNRDIFISTIIYDKSSDEVWICWSNSFCKK
LVSVTMDAAKGQTEDIEVLDYYKHQLDLLAQMCHNQQYLAIDPPPERRLLNLSLELPADLVLKCVSDTRLPQDLRASFTR
LMLHLHVIRGSPLNAVHHARLWREIPLHVTISGNSSRSVNGYVDGSHIHTEGEVFDKLLKTVDVYLEELCKTTREGEPVL
DPSASKLEQNRLTFEIVTLARALAHFGFYSFADLLHLAQNLLIIADSSPKKPGAKMSFDKTALFRQVTYSVIGVNALQKG
AKQYLSHMEAETCTENSLLAKESKQMILQTKLIIVEILNFIMDVRRDYRITVALSWFKQRFPCDEFGELLSRADLSEHEA
SQLHKEVFQVGEEKLDFDGKNGQLVLRILLQMTITDFSKLTSTALTVLFRHFTQYQEFVEDLKQVQLLVSNDDVENYQQI
DRDLFILKILTEKSELWVQSDKTRSGSSSSPSFDEHTSSPDDSSKPSLAVQTTSQQLKDYGLNASCAFHNDESFRSLVET
IEQHYFSSRDECIKLLCELLLGDDRAEASSALYELSDRAPFISYPLLRQILYRVKQLCYKNEKPDKMNQQLLRNMRVHKY
VLKFLSVPYDKKNDVEMPRLITLSHEFLRSFCRNNVENQFRLYKHISIEQNAKEGCLSVNTVEEVATLTAIFKNNRILCE
NVSEELIAHIINMIEHKARSAVYIEFLQTVVMVQEKEIKSAQEKVAEEICSSSDDVRVFYADSASFEQLKQLMQNTGPEE
LNADHPLRYHIDLVRLLALCTRGRNNTTELKCASQLSMDHIVRVLTSPYCLIQVKEVYLQFMLHCYIDADAEMKDIDNID
FIEKILKNILRDIQVYLGTLLELKTEKSTFLPNSALEKYICHTVTEVLIKLFERSSTHKLIMEIPEHRQSFSKMIQSLNQ
LQEELTRKNFTKNYYRVAECIRRLSRCAEENAVMLPVNGCMPSASAETTAKQHWQSAFNSVRFISQANKRTKTRLNVPDY
VQIAESFSDVVSCYEAMVAEFKMFALPLQAAETSVLVDVFHAPERLFTPGSDLYQECENGGVIAKLIQHCKSLLQHEQKT
LCVRVLQTLCRMASNAKCNFINQAEEVRIRLLKRYFGDDAVFSVKTNEQTTKLEGNGIPKILPYSLCMHSYFRFTFSECE
FGHELKPIKELSLYDVQCKLNSAGASDLIIDLIMREPSHEVFLMTIQLSKALLHEGNYEVQMSFYNRLKEQNTSEPFFNA
LKTKLQVAQNRLKSDMMACNDSRQRHSVSNSVSGRSSVMNSPSPEDSTYTLKELKSVDINSIDLTVSLSAVPDGYFPGLF
DPDVNLNFWDDKKTLLSQEVALIEPILRFLQLLCENHNLMLQNFLRYQGSRQNHNLVDETLMFLDVICGSTKGCLGVFGE
IGEHNSSLITQTLVTLTEFCQGPCNENQNTVGSHESGLNMIISLVLNEIKPLCLTHMDLALEIKAKISAASKLLLAVMES
RRDADNAERILMNMDHMDTGAKQLVQAIKVAYGMSELNEFTTSKITKNYETGCSLIKMKPRISRPDIAIQDGFITSYPST
NITLVNPQEVGHNIFILATQLSRYNETLREALNPENNKDELTSKALRYYKQYTAQIEIVRSDRKMERVIFPIHAICEYLT
PESKLNILLETEQDAQGSKVTEFFGQWPKLFEEMKWQKKLQDRKYFSNCTKRLILWARISFFFAILVNTVIAISYPFSGN
SRQEIISPSNPFLYVFPMVSLLFLRTQWSEKASLGRTNEIYWAFAGIMSSFTILFITVIGVVLTLSVIGLLQLINKSVHI
VSYIGNRGLIDKTWRERLQDKGIWYHLAYLLICIQGLFVHPLFYALLLFDIVASEETLRNVIRSVTRNWRSIIMTGLLAV
ILVYLFSIIGYLYFQKDFQLEVDELDDSEKDNVAAENLPSMECIHLQSSIFRQYINQNMCSEMKNSRSNQPIDDKGELKV
WSCQTLRMCILTTLNWGLRNGGGIGDVLRNVAPHEESFLSRIIYDMTFFIVIIVIVLNLVFGVIIDTFGDLRAERNEKVD
QLRNNCFICGLERGRFDNKIVTFEEHRKNEHNLYHYLYFIVWLQIKDETEFTGPESYEHKSDWFPRMQAMSLAEDNQEVE
QTDDINEIHDSIDKLLDVVKKQGRQLEELKQVMDISRNILRTKLPDIKLHGACQHLINSRRFIIKSLYML
Estimated Isoelectric Point:
6.17664337158203
Estimated Molecular Weight:
330.1 kD
Amino Acid Composition:
Amino Acid Frequency
Thr144
Lys177
Gln142
Leu338
Gly107
Met69
Ser220
Tyr94
His83
Glu210
Arg149
Cys62
Phe135
Pro91
Val180
Asn156
Ala145
Ile188
Trp27
Asp153