Sequence:
download
OVP01210sequence.fasta
>Ovo-AMA-1 MALVGVDFRAPLRIVKRVQFGILSPDEIKRMSIGEIEFSEIYENGKPKLGGLMDPRQGVVDRRGRCMTCAGSLADCPGHF AHIELAKPVFHIGFLSKTLKLLRCVCFYCSRLMVDKDSPRVKELLKKTAGNARRRLTVIYEICKSKTVCEGGDELHTIGG EDGEESEREVKSGGCGRYQPSYKRVGIDIIAEWKKHINEDTQERKIILTAERALEIFKSISDSDCLILGMDPRYARPDWM IAQVIPVPPLAVRPAVVTFGSARNQDDLTHKLSDIVKTNNQLKRNEANGAAAHVLAEDIKLLQYHVATLIDNSIPGLPPA TQKGGRPLKSIKQRLKGKEGRIRGNLMGKRVDFSARTVITPDPNLPIDTVGVPRTIAQNMTFPEIVTPFNIDKLQELVNR GDSQYPGAKYIIRENGARVDLRYHPRAADLHLQPGYRVERHMKDGDIIVFNRQPTLHKMSMMGHKVKILPWSTFRLNLSV TTPYNADFDGDEMNLHLPQSLETKAEVSEIAMVPRQLITPQANKPVMGIVQDTLTAVRMMTKRDVFIELPRMMDLLMQMP NWDGKVPQPAILKPKPLWTGKQVFTLIIPGNVNVLRTHSTHPDDEDNGPYKWISPGDTKVIIEHGELLSGIICSRTVGRS AGNLLHVVTLELGWEVAAHFYSHIQTVVNAWLLAEGHTIGIGDTIADQATYRDIQETIRKAKLDVVEVIEKAHNDELEPT PGNTLRQTFENMVNRILNDARDRTGGSAQRSLSEYNNFKAMVVAGSKGSKINISQVIACVGQQNVEGKRIPFGFRHRTLP HFIKDDYGPESKGFVENSYLAGLTPSEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMVSYDGTVRNSLGQLVQ LRYGEDGLDGMWVENQSMPSMKPTIALFEKEFKLDLSDEKSLRKMYTENVVRELQGSAEALKEVETEWAQLEEDRRLLRK IFPKGDAKIVLPCNLQRMIWNAQKIFRVELRKPTDLNPLRVIEGVNELSKKLVIVSGEDRISKQAQYNATLLMNILLRST LCAKRMAEKHRLNSEAFEWLIGEIESRFKQAIVQPGEMVGAIAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEII NVSKKPKTPSLTVFLQGTAAKDAEKAKDVLCKLEHTTLRKVTANTAIYYDPDPKNTIIEEDQEWVNIFYEMPDFDPSRCS PWLLRIELDRRRMTDKKLTMEAIADKIHQGFGDDLNVIYTDDNAEKLVFRLRIANQDGDKSNEDEQVERMEDDVFLRCIE TNMLSDLTLQGIEAITKVYMHKPTTDDKKRVVITPDGGFKAIPEWLLETDGTALAKVLSEQNVDPIRTTSNDICEIFEVL GIEAVRKAIEREMNHVISFDGSYVNYRHLALLCDVMTAKGHLMAITRHGINRQEVGALMRCSFEETADILMEAAVHAEQD PVKGVSENIMLGQLARAGTGCFDLVLDVDKCKLAMEIQTGGGLLGTGGMYFGSSMSPTSSSMSPAQTPWNAGTTPAYGAA WSPATGSGMTPGGAGFSPSGHSEGGFSPYGGSGSWSPGSPGGSLGGMSPSGAGAYSPAASDYGSGLEGLSSPGYSPTSPA SPYGASSPAYGVMSPRYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPGYSPTSPSYSPTSPSYSPTSPSY SPASPGYSPSSPRYSPTSPAYSPTSPTYSPTSPAYSPTSPTYSPTSPSYSPASPGYSPSSPRYSPTSPTYSPTSPAYSPS SPQYSPSSPQYSPSSPQYTPSSPAGDASPAYSPTSPQYSPSSPRYSPSSPQYSPTSPQYSPSSPGGAGTTYSRSSPQYSP SSPQYSPSSPQVFFVLLTLYVRILFF
view sequence (1866 aa)
>Ovo-AMA-1
MALVGVDFRAPLRIVKRVQFGILSPDEIKRMSIGEIEFSEIYENGKPKLGGLMDPRQGVVDRRGRCMTCAGSLADCPGHF
AHIELAKPVFHIGFLSKTLKLLRCVCFYCSRLMVDKDSPRVKELLKKTAGNARRRLTVIYEICKSKTVCEGGDELHTIGG
EDGEESEREVKSGGCGRYQPSYKRVGIDIIAEWKKHINEDTQERKIILTAERALEIFKSISDSDCLILGMDPRYARPDWM
IAQVIPVPPLAVRPAVVTFGSARNQDDLTHKLSDIVKTNNQLKRNEANGAAAHVLAEDIKLLQYHVATLIDNSIPGLPPA
TQKGGRPLKSIKQRLKGKEGRIRGNLMGKRVDFSARTVITPDPNLPIDTVGVPRTIAQNMTFPEIVTPFNIDKLQELVNR
GDSQYPGAKYIIRENGARVDLRYHPRAADLHLQPGYRVERHMKDGDIIVFNRQPTLHKMSMMGHKVKILPWSTFRLNLSV
TTPYNADFDGDEMNLHLPQSLETKAEVSEIAMVPRQLITPQANKPVMGIVQDTLTAVRMMTKRDVFIELPRMMDLLMQMP
NWDGKVPQPAILKPKPLWTGKQVFTLIIPGNVNVLRTHSTHPDDEDNGPYKWISPGDTKVIIEHGELLSGIICSRTVGRS
AGNLLHVVTLELGWEVAAHFYSHIQTVVNAWLLAEGHTIGIGDTIADQATYRDIQETIRKAKLDVVEVIEKAHNDELEPT
PGNTLRQTFENMVNRILNDARDRTGGSAQRSLSEYNNFKAMVVAGSKGSKINISQVIACVGQQNVEGKRIPFGFRHRTLP
HFIKDDYGPESKGFVENSYLAGLTPSEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMVSYDGTVRNSLGQLVQ
LRYGEDGLDGMWVENQSMPSMKPTIALFEKEFKLDLSDEKSLRKMYTENVVRELQGSAEALKEVETEWAQLEEDRRLLRK
IFPKGDAKIVLPCNLQRMIWNAQKIFRVELRKPTDLNPLRVIEGVNELSKKLVIVSGEDRISKQAQYNATLLMNILLRST
LCAKRMAEKHRLNSEAFEWLIGEIESRFKQAIVQPGEMVGAIAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEII
NVSKKPKTPSLTVFLQGTAAKDAEKAKDVLCKLEHTTLRKVTANTAIYYDPDPKNTIIEEDQEWVNIFYEMPDFDPSRCS
PWLLRIELDRRRMTDKKLTMEAIADKIHQGFGDDLNVIYTDDNAEKLVFRLRIANQDGDKSNEDEQVERMEDDVFLRCIE
TNMLSDLTLQGIEAITKVYMHKPTTDDKKRVVITPDGGFKAIPEWLLETDGTALAKVLSEQNVDPIRTTSNDICEIFEVL
GIEAVRKAIEREMNHVISFDGSYVNYRHLALLCDVMTAKGHLMAITRHGINRQEVGALMRCSFEETADILMEAAVHAEQD
PVKGVSENIMLGQLARAGTGCFDLVLDVDKCKLAMEIQTGGGLLGTGGMYFGSSMSPTSSSMSPAQTPWNAGTTPAYGAA
WSPATGSGMTPGGAGFSPSGHSEGGFSPYGGSGSWSPGSPGGSLGGMSPSGAGAYSPAASDYGSGLEGLSSPGYSPTSPA
SPYGASSPAYGVMSPRYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPGYSPTSPSYSPTSPSYSPTSPSY
SPASPGYSPSSPRYSPTSPAYSPTSPTYSPTSPAYSPTSPTYSPTSPSYSPASPGYSPSSPRYSPTSPTYSPTSPAYSPS
SPQYSPSSPQYSPSSPQYTPSSPAGDASPAYSPTSPQYSPSSPRYSPSSPQYSPTSPQYSPSSPGGAGTTYSRSSPQYSP
SSPQYSPSSPQVFFVLLTLYVRILFF
Estimated Isoelectric Point:
7.07727813720703
Estimated Molecular Weight:
205.1 kD
Amino Acid Composition:
Amino Acid Frequency
Thr119
Lys99
Gln65
Leu144
Gly140
Met55
Ser184
Tyr72
His36
Glu109
Arg102
Cys22
Phe52
Pro153
Val109
Asn64
Ala122
Ile107
Trp18
Asp94