Sequence:
download
JA68016sequence.fasta
>Cjp-ERM-1 MSKKAINVRVTSMDSELEFAIQSSTTGKQLFDQVVKTIGLREIWYFGLQYTDNKGFPTWLKLNKKVMSQDVRKDPTLVFK FRAKFYPEDVAEEIIQDVTMRLFYLQVKDGILSDEIYCPPETSVLLASYAMQAKYGDYVPETHVAGCLTADRLLPQRVLG QFKLNSEEWERRIMTWWADHRGTTREQAMLEYLKIAQDLEMYGVNYFEIRNKKGTDLYLGVDALGLNIYDKADRLSPKVG FPWSEIRNISFNDKKFVIKPIDKKAHDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTIEVQQMKQQAREERALKIAE QEKLTREMSAREEAEARQRDAEKRIAQMQEDMERARLELAEAHNTIHSLEAQLKQLQLAKQALEQKEYELRELTAQLQSE KAMSDDERRRLRDQVDAREREVYTMRQEVERQTTVTRQLQTQITTQQHVQHSYSSHVTNGHARDESATDDEDNGATELTN DADQNVPQHELDRVTAAEKNIQIKNKLDMLTRELDSVKDQNAITDYDVLHMENKKAGRDKYKTLRQIRGGNTKRRIDQYE NM
view sequence (562 aa)
>Cjp-ERM-1
MSKKAINVRVTSMDSELEFAIQSSTTGKQLFDQVVKTIGLREIWYFGLQYTDNKGFPTWLKLNKKVMSQDVRKDPTLVFK
FRAKFYPEDVAEEIIQDVTMRLFYLQVKDGILSDEIYCPPETSVLLASYAMQAKYGDYVPETHVAGCLTADRLLPQRVLG
QFKLNSEEWERRIMTWWADHRGTTREQAMLEYLKIAQDLEMYGVNYFEIRNKKGTDLYLGVDALGLNIYDKADRLSPKVG
FPWSEIRNISFNDKKFVIKPIDKKAHDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTIEVQQMKQQAREERALKIAE
QEKLTREMSAREEAEARQRDAEKRIAQMQEDMERARLELAEAHNTIHSLEAQLKQLQLAKQALEQKEYELRELTAQLQSE
KAMSDDERRRLRDQVDAREREVYTMRQEVERQTTVTRQLQTQITTQQHVQHSYSSHVTNGHARDESATDDEDNGATELTN
DADQNVPQHELDRVTAAEKNIQIKNKLDMLTRELDSVKDQNAITDYDVLHMENKKAGRDKYKTLRQIRGGNTKRRIDQYE
NM
Estimated Isoelectric Point:
6.68421173095703
Estimated Molecular Weight:
65.9 kD
Amino Acid Composition:
Amino Acid Frequency
Thr35
Lys43
Gln42
Leu50
Gly20
Met19
Ser22
Tyr21
His12
Glu51
Arg47
Cys3
Phe15
Pro13
Val30
Asn22
Ala42
Ile28
Trp6
Asp41