Sequence:
download
JA67425sequence.fasta
>CJA09385, isoform c MLTFIGDALAGPLRARRGSASGQLTMLSTTSPFITSDPGKQNAYCDASANLLTNIFLVDVSDPIIGTIDDKLSKISNFLL NVPSQVNLSSNDDWNGQEFRLVVYGGNEPFPLGRARNQQSWNKVVSELNTTIVNPTKLDGHQMTDALRFVFNNYRPAYGT AGNIIVVGDGFDFDEMESATTISTALKYQYRFSLGFLLMTTSQVQRSVVQPLASDFSHFYPIDSVDYLSNPAVVQTQANW ICSAFYPVPAPPTPPPTRLPLLTTATTAGPLTQTTANPLLPPISSCTQNVLFLIDQSQTLLVNGYNKGYTSLSQFISSIS NAPQTLGNSDAKVNNLDNSVANVQNVTKSIRSRLQTEIIGIDLRETVSNKKNVQNIIQFDVLDGLPESIYVGVSQPDAIL DDQIINSTSYKLRCKGSSNCFTGITFVMETSQAEGYNYVDVQKLSIINVLNHYTAPVSVSLVYFSSPDSLDPNNPDRSGI LFGQITNSTNAINILNTTNFDLGAASDLELGFTKTLESLNKGYLENNNLVIFFARGAYERLSNCCPDPTAAANAVKQQAT VQGVMIGPYSSKSQLDSLTGSNSIDANALIGGNTLNSTQDRLDAADQISDAIIPIIDSFLNNEVCSGIPGYADPPCEDPI DVLVLLHANSLENWNRIKNFTANELLPSLLGETGAVANKQLTTSTPVNFAVASYYYLDVVDHADFTYLLSVEDYQNLLTK ISYRETKGTATLSTAYKKAIEIFEDGRPYASKNLILITDTLDISDLEDAFSEHDAMTQLVGGYTTALAINTDIIPGADYQ INIDPSQLDSYNRYTRRKLANSLTQNNCVYKPVQVPTLPPVTPSPTLPGPIPLVKARNVWPDITILIDTSKSQENPMNDE LFEKIRAFLDILLIQYSVGKHGSRFTVATYDGDTVEYSCIFDQDSYYDLSSCRNERLSLFSRNHENYRNVDGVLSDVLHN VYQNNTSGYRSLNENFLVLFTLGASSTPFTQQLKNIERKGIRTIAIGLSNNISNNDLSQFSRTAFSVPDWSSSFSGIDTN YDLADRIFQITTKKRLPSSSNFFGNLVFIVDQSGNSASDHSNIVQYVTDFVTPYLIDPVKTQISIVPFAGSVISPLSINS SQTEVDSWLDSWKLTTASSDYSANVGSAIQFAASELGSTYDRPTHVVFVLGSANVTGTELAQQLLNGSNLYVASYNIANN TDFNNLVFTSDRIYSVNSSVELLNRVVSLDVTKPNPMLVLDKDILETQEKNDQSSFPTSSIAADVIMLLDETGLEDNEFE TMKQFLSNFTQKFSVGSESTQFALQSYNGRTIPHDGFHLYESTSGEVVKNRIQQLTLAKAAENSTDADLAGAIEQEIFFF LTEKNGWREDTTTYTIIFSHADSFYTRDTDTAMGVKNVSSVFSLGVNGMKFDYVQNFTNTGFYETVAGVSALNINAPEVA DLLAAINNDYKNLVYPSTHSVKEIVKADFIFLIDSSLGSSKNQAVQQFLLDFTANVGTFSSSGNDTRMAVVVYGKSATTL WNLQNAQDIDSLRNRISQIQITSSSSGTVNLRRAIDSIILNEGDFGVDYNRPEYIIDIASSLTISPTIDTATSRHLNTRY STFVMQTNNDNSTFSYCSQVLGTKLFTDRVAINPELSFDNSEAQGKLFSWISNEFSAWSTTFPDKS
view sequence (1666 aa)
>CJA09385, isoform c
MLTFIGDALAGPLRARRGSASGQLTMLSTTSPFITSDPGKQNAYCDASANLLTNIFLVDVSDPIIGTIDDKLSKISNFLL
NVPSQVNLSSNDDWNGQEFRLVVYGGNEPFPLGRARNQQSWNKVVSELNTTIVNPTKLDGHQMTDALRFVFNNYRPAYGT
AGNIIVVGDGFDFDEMESATTISTALKYQYRFSLGFLLMTTSQVQRSVVQPLASDFSHFYPIDSVDYLSNPAVVQTQANW
ICSAFYPVPAPPTPPPTRLPLLTTATTAGPLTQTTANPLLPPISSCTQNVLFLIDQSQTLLVNGYNKGYTSLSQFISSIS
NAPQTLGNSDAKVNNLDNSVANVQNVTKSIRSRLQTEIIGIDLRETVSNKKNVQNIIQFDVLDGLPESIYVGVSQPDAIL
DDQIINSTSYKLRCKGSSNCFTGITFVMETSQAEGYNYVDVQKLSIINVLNHYTAPVSVSLVYFSSPDSLDPNNPDRSGI
LFGQITNSTNAINILNTTNFDLGAASDLELGFTKTLESLNKGYLENNNLVIFFARGAYERLSNCCPDPTAAANAVKQQAT
VQGVMIGPYSSKSQLDSLTGSNSIDANALIGGNTLNSTQDRLDAADQISDAIIPIIDSFLNNEVCSGIPGYADPPCEDPI
DVLVLLHANSLENWNRIKNFTANELLPSLLGETGAVANKQLTTSTPVNFAVASYYYLDVVDHADFTYLLSVEDYQNLLTK
ISYRETKGTATLSTAYKKAIEIFEDGRPYASKNLILITDTLDISDLEDAFSEHDAMTQLVGGYTTALAINTDIIPGADYQ
INIDPSQLDSYNRYTRRKLANSLTQNNCVYKPVQVPTLPPVTPSPTLPGPIPLVKARNVWPDITILIDTSKSQENPMNDE
LFEKIRAFLDILLIQYSVGKHGSRFTVATYDGDTVEYSCIFDQDSYYDLSSCRNERLSLFSRNHENYRNVDGVLSDVLHN
VYQNNTSGYRSLNENFLVLFTLGASSTPFTQQLKNIERKGIRTIAIGLSNNISNNDLSQFSRTAFSVPDWSSSFSGIDTN
YDLADRIFQITTKKRLPSSSNFFGNLVFIVDQSGNSASDHSNIVQYVTDFVTPYLIDPVKTQISIVPFAGSVISPLSINS
SQTEVDSWLDSWKLTTASSDYSANVGSAIQFAASELGSTYDRPTHVVFVLGSANVTGTELAQQLLNGSNLYVASYNIANN
TDFNNLVFTSDRIYSVNSSVELLNRVVSLDVTKPNPMLVLDKDILETQEKNDQSSFPTSSIAADVIMLLDETGLEDNEFE
TMKQFLSNFTQKFSVGSESTQFALQSYNGRTIPHDGFHLYESTSGEVVKNRIQQLTLAKAAENSTDADLAGAIEQEIFFF
LTEKNGWREDTTTYTIIFSHADSFYTRDTDTAMGVKNVSSVFSLGVNGMKFDYVQNFTNTGFYETVAGVSALNINAPEVA
DLLAAINNDYKNLVYPSTHSVKEIVKADFIFLIDSSLGSSKNQAVQQFLLDFTANVGTFSSSGNDTRMAVVVYGKSATTL
WNLQNAQDIDSLRNRISQIQITSSSSGTVNLRRAIDSIILNEGDFGVDYNRPEYIIDIASSLTISPTIDTATSRHLNTRY
STFVMQTNNDNSTFSYCSQVLGTKLFTDRVAINPELSFDNSEAQGKLFSWISNEFSAWSTTFPDKS
Estimated Isoelectric Point:
4.60224151611328
Estimated Molecular Weight:
183.0 kD
Amino Acid Composition:
Amino Acid Frequency
Thr140
Lys55
Gln76
Leu156
Gly85
Met16
Ser182
Tyr63
His16
Glu59
Arg54
Cys13
Phe82
Pro73
Val113
Asn138
Ala107
Ile111
Trp12
Asp115