Sequence:
download
JA64735sequence.fasta
>Cjp-UNC-31 MLGASSSEEEDDDFQDDHDSMPISQVKKRSLLSGALTPRSSSPAPSDSISQTNSLKRNNSNMGRRKDSVHSQTPARSPMR MNAPSPMPQSRTMSNVSKPNLHESQEFDADEDGEEEGSQTVVASDDGGPALSKEEQERIKAEKEEEDHKKNLQMYVFLAR CIAYPFNGQQTGDMARRQMKVNKQELGRIRDRFTAFLKGETNIAADEAFTKAIQSYFEVFLKSERVQKVVHAGGFSQHDF REVFRLNIEKRIRSLPDIEGLSKDTVLNSWLAKFDAIIKGDETDQNRNARGRSRNPQGAMSADAVLGKEQLYDVFQQILG VKKFEHQIIFNALQLDNPDEQAAAIRREFATREEALKDPMKMKRLTPKFVVKDMETLYMDEVRMSINTLISNLETVPVTT RGQTVGKRKDKSRNQTKNKRSRSIEDLSLFNSLKRRTSSGSLNKGDSDDGDVTLTKSDVSLALSMEVVVMEVQGLKSVQP SKIVYCTMEVDGRKLQTDHAEASKPKWDTQGDFSTKNPLPVVKVKLYTEVKSIVAFEDKELGKVIIQPTPNCSRSPEWYT MTLPKNSQDPNLKIRIAIRVEKPPNLKYCGHCYCIGRSAWKKWKKRFFCLVQVSQYAFAVCSFRQKKADPTEFIQLDGFT IDYMPEPDPELTAQGGKHFFTAIKEGDELKFATDDENERHLWVQALYRATGQAYKPVPPKQSTIAPKAQGFQDKASKHGM DALIQADSINHDHDHFFSEIQQQTLDFRINEPICSLGWFSPGQAFVLEEYSARYMVRGCFRHVTLLSNLLDKADDGLLID PALIHYSFAFCASHVHGNRCMPDRQGPEGVGTVTQEEKEKFQEIKERLRVLLEKQITNFRYCFPFGRPEGALKGTLGLLE RVLMKDVVSPVPPEEVRAVIRKCLEDAALINYTRICNEAKIEQRMGIDVSPAQRIEDMIRVTEFCIDLLKENEEHHGEAF AWFSDLLSDHSEIFWSLYSVDLDSALEVQPHDSWDSFPLFQMLNDFLLSEPTLKGGIFHNKIVQQFQPLVVRYIDLMEHS IAQAIDKGFLKEKWESRKEGCATSEDIYWKLDALHTFVIDLNWPEEDFRKYLQTKMKSLTSDMISKVSDCTFQAFDGWMQ RAKKSTDYMLPSEVCVQINVMFSSKSRAIRVTVDSGEYKYQSKLDETLETMLKTMESCIQEKLLGVLESVLSRLARYDEG NPIGAILNIAPKPASIFNKLKTMAGDTSAQTATAARQPLTAQQSSGQIGNSYVTFFRGCTELLRQIVIDEIWVNCLFEHW YDNQMKAINEWLTERLQQSLSATQFISLSNIVKKVYGDFELQGIDEERLNSKTYQSISRRLQLEESNSHIQEASANGSAT SSVFPSSLGNATAAVSNMSSMVEGAGAKMFSLFK
view sequence (1394 aa)
>Cjp-UNC-31
MLGASSSEEEDDDFQDDHDSMPISQVKKRSLLSGALTPRSSSPAPSDSISQTNSLKRNNSNMGRRKDSVHSQTPARSPMR
MNAPSPMPQSRTMSNVSKPNLHESQEFDADEDGEEEGSQTVVASDDGGPALSKEEQERIKAEKEEEDHKKNLQMYVFLAR
CIAYPFNGQQTGDMARRQMKVNKQELGRIRDRFTAFLKGETNIAADEAFTKAIQSYFEVFLKSERVQKVVHAGGFSQHDF
REVFRLNIEKRIRSLPDIEGLSKDTVLNSWLAKFDAIIKGDETDQNRNARGRSRNPQGAMSADAVLGKEQLYDVFQQILG
VKKFEHQIIFNALQLDNPDEQAAAIRREFATREEALKDPMKMKRLTPKFVVKDMETLYMDEVRMSINTLISNLETVPVTT
RGQTVGKRKDKSRNQTKNKRSRSIEDLSLFNSLKRRTSSGSLNKGDSDDGDVTLTKSDVSLALSMEVVVMEVQGLKSVQP
SKIVYCTMEVDGRKLQTDHAEASKPKWDTQGDFSTKNPLPVVKVKLYTEVKSIVAFEDKELGKVIIQPTPNCSRSPEWYT
MTLPKNSQDPNLKIRIAIRVEKPPNLKYCGHCYCIGRSAWKKWKKRFFCLVQVSQYAFAVCSFRQKKADPTEFIQLDGFT
IDYMPEPDPELTAQGGKHFFTAIKEGDELKFATDDENERHLWVQALYRATGQAYKPVPPKQSTIAPKAQGFQDKASKHGM
DALIQADSINHDHDHFFSEIQQQTLDFRINEPICSLGWFSPGQAFVLEEYSARYMVRGCFRHVTLLSNLLDKADDGLLID
PALIHYSFAFCASHVHGNRCMPDRQGPEGVGTVTQEEKEKFQEIKERLRVLLEKQITNFRYCFPFGRPEGALKGTLGLLE
RVLMKDVVSPVPPEEVRAVIRKCLEDAALINYTRICNEAKIEQRMGIDVSPAQRIEDMIRVTEFCIDLLKENEEHHGEAF
AWFSDLLSDHSEIFWSLYSVDLDSALEVQPHDSWDSFPLFQMLNDFLLSEPTLKGGIFHNKIVQQFQPLVVRYIDLMEHS
IAQAIDKGFLKEKWESRKEGCATSEDIYWKLDALHTFVIDLNWPEEDFRKYLQTKMKSLTSDMISKVSDCTFQAFDGWMQ
RAKKSTDYMLPSEVCVQINVMFSSKSRAIRVTVDSGEYKYQSKLDETLETMLKTMESCIQEKLLGVLESVLSRLARYDEG
NPIGAILNIAPKPASIFNKLKTMAGDTSAQTATAARQPLTAQQSSGQIGNSYVTFFRGCTELLRQIVIDEIWVNCLFEHW
YDNQMKAINEWLTERLQQSLSATQFISLSNIVKKVYGDFELQGIDEERLNSKTYQSISRRLQLEESNSHIQEASANGSAT
SSVFPSSLGNATAAVSNMSSMVEGAGAKMFSLFK
Estimated Isoelectric Point:
6.01770782470703
Estimated Molecular Weight:
158.1 kD
Amino Acid Composition:
Amino Acid Frequency
Thr69
Lys102
Gln79
Leu114
Gly70
Met41
Ser121
Tyr31
His28
Glu105
Arg77
Cys22
Phe67
Pro59
Val80
Asn55
Ala92
Ile74
Trp17
Asp91