Sequence:
download
JA64482sequence.fasta
>Cjp-MOG-4 MSVEQFINDQLHSIVGISDRTICQYVHALAKKSRNAGDLVEKLRDSGDFPISAAIQNFAQQLMDRMPRVSVAQKQRGPSA QELAEQELKRLNRAVGVIHEEQQAVKKGRNSRKRKESSSDDEAPQKSQKPTKSAARKEESDDSDIEAIDAKLDADIAERD ALAARINKKEKERTRNVMEKKRDDNKDKEGTTMEKLREESRRQYLAKRKVDKLEELAAIVHDDQTLFAKEKLTKREREDM EYRQKVLEYATAHEKAGDVMKIKRYHLPDASQKTIPSTYIEDEEDFRPGGDGAKWEEEQLMASMLHLGAKDAKKKEQEFE LLLDEQIDFIQALQMPGTNEEEAKESEAEKKKMSIQETRRSLPVYAFREAFIEAVKEHQVLIIEGETGSGKTTQLPQYLY EAGFCEGGKRIGCTQPRRVAAMSVSARVAEEVGCKLGTQVGYSIRFEDCTSEKTVLKYMTDGMLLREFLNEPDLSSYSVM MIDEAHERTLHTDILFGLVKDIARFRKDLKLLISSATLDAEKFSSFFDDAPIFRIPGRRFPVDIYYTQAPEADYLDAAIV TVMQIHLTQPLPGDILVFLTGQEEIETVMEALMERSKALGSKIKELIPLPVYANLPSDLQAKIFEPTPKDARKVVLATNI AETSVTIDGICYVIDPGFSKQNSFDARSGVEHLHVVTISKAAANQRAGRAGRTGPGKCFRLYTAWAYKHELEEQPIPEIQ RTNLGNVVLMLKSLGIHDLVHFDFLDPPPQETLVIALEQLYALGALNHRGELTKLGRRMAEFPCDPCMSKMIIASEKYEC SEEIVTIAAMLSCNAAVFYRPKAQVIHADSARKGFWSPAGDHITLMNVYNKWKESQFSQRWCVENYVQHRTMKRARDVRD QLVGLLERVEIEPKSSNDTIAIRKAITAGYFYNVSKLDNTGHYKTVKHKHTTHPHPNSCLFEETPRWVVYYELVFTSKEF MREMSEIESGWLLEVAPHYYKGRELEDSTNKKMPKQRGKSARELER
view sequence (1006 aa)
>Cjp-MOG-4
MSVEQFINDQLHSIVGISDRTICQYVHALAKKSRNAGDLVEKLRDSGDFPISAAIQNFAQQLMDRMPRVSVAQKQRGPSA
QELAEQELKRLNRAVGVIHEEQQAVKKGRNSRKRKESSSDDEAPQKSQKPTKSAARKEESDDSDIEAIDAKLDADIAERD
ALAARINKKEKERTRNVMEKKRDDNKDKEGTTMEKLREESRRQYLAKRKVDKLEELAAIVHDDQTLFAKEKLTKREREDM
EYRQKVLEYATAHEKAGDVMKIKRYHLPDASQKTIPSTYIEDEEDFRPGGDGAKWEEEQLMASMLHLGAKDAKKKEQEFE
LLLDEQIDFIQALQMPGTNEEEAKESEAEKKKMSIQETRRSLPVYAFREAFIEAVKEHQVLIIEGETGSGKTTQLPQYLY
EAGFCEGGKRIGCTQPRRVAAMSVSARVAEEVGCKLGTQVGYSIRFEDCTSEKTVLKYMTDGMLLREFLNEPDLSSYSVM
MIDEAHERTLHTDILFGLVKDIARFRKDLKLLISSATLDAEKFSSFFDDAPIFRIPGRRFPVDIYYTQAPEADYLDAAIV
TVMQIHLTQPLPGDILVFLTGQEEIETVMEALMERSKALGSKIKELIPLPVYANLPSDLQAKIFEPTPKDARKVVLATNI
AETSVTIDGICYVIDPGFSKQNSFDARSGVEHLHVVTISKAAANQRAGRAGRTGPGKCFRLYTAWAYKHELEEQPIPEIQ
RTNLGNVVLMLKSLGIHDLVHFDFLDPPPQETLVIALEQLYALGALNHRGELTKLGRRMAEFPCDPCMSKMIIASEKYEC
SEEIVTIAAMLSCNAAVFYRPKAQVIHADSARKGFWSPAGDHITLMNVYNKWKESQFSQRWCVENYVQHRTMKRARDVRD
QLVGLLERVEIEPKSSNDTIAIRKAITAGYFYNVSKLDNTGHYKTVKHKHTTHPHPNSCLFEETPRWVVYYELVFTSKEF
MREMSEIESGWLLEVAPHYYKGRELEDSTNKKMPKQRGKSARELER
Estimated Isoelectric Point:
6.29605865478516
Estimated Molecular Weight:
114.6 kD
Amino Acid Composition:
Amino Acid Frequency
Thr50
Lys83
Gln46
Leu82
Gly49
Met29
Ser61
Tyr31
His26
Glu100
Arg67
Cys13
Phe34
Pro41
Val57
Asn26
Ala87
Ile57
Trp7
Asp60