Sequence:
download
JA64180sequence.fasta
>Cjp-RAD-54.L MVNTTQRCETLYNKLIECEKQNRIIEKDKGATASALSFITHLKKLCNHPYLVYEELQKPENRFSSKCLSVFPDTFNPKSF DPSFSGKMKVLDYILAVTRKTTDDRFVLVSNYTQTIDQFMELCKLRGYDFVRLDGSMSIKQRSKIVDTFNDPTSNVFCFL LSSKAGGCGLNLIGANRLVMFDPDWNPANDDQAMARVWRDGQKKMCFIYRLLATGSIEEKMFQRQTHKKALSSCVVDAGE DVARHFSTEQLRELFKLESSVASDTHEKLKCKRCIQGVESLDPPATADCASDLSNWFHSQKSARKVADNVLRAVFECGSI SFVFHQKSHNVEVKKSAEKVEEKDEEYVPSEAEELDEDE
view sequence (359 aa)
>Cjp-RAD-54.L
MVNTTQRCETLYNKLIECEKQNRIIEKDKGATASALSFITHLKKLCNHPYLVYEELQKPENRFSSKCLSVFPDTFNPKSF
DPSFSGKMKVLDYILAVTRKTTDDRFVLVSNYTQTIDQFMELCKLRGYDFVRLDGSMSIKQRSKIVDTFNDPTSNVFCFL
LSSKAGGCGLNLIGANRLVMFDPDWNPANDDQAMARVWRDGQKKMCFIYRLLATGSIEEKMFQRQTHKKALSSCVVDAGE
DVARHFSTEQLRELFKLESSVASDTHEKLKCKRCIQGVESLDPPATADCASDLSNWFHSQKSARKVADNVLRAVFECGSI
SFVFHQKSHNVEVKKSAEKVEEKDEEYVPSEAEELDEDE
Estimated Isoelectric Point:
6.12451934814453
Estimated Molecular Weight:
40.9 kD
Amino Acid Composition:
Amino Acid Frequency
Thr18
Lys32
Gln14
Leu30
Gly13
Met8
Ser32
Tyr8
His8
Glu28
Arg18
Cys13
Phe21
Pro11
Val25
Asn16
Ala22
Ile13
Trp3
Asp26