Sequence:
download
JA63836sequence.fasta
>Cjp-DOP-3, isoform a MLTGQHHVPGIESPLMVVLWRVAAGVFLPLVPTMAVFGNALVIMSVFRERSLQTVTNMLIVSLAVSDFMVAIGVMSFGVY YEWNSFKWGLGAFFCHVYQALDVACSTASILNLLAISLDRYIAIGHPISYAQYGARGGRAMISITIVWGVSIAVALPLLL GVNPMENDMVRPN
view sequence (173 aa)
>Cjp-DOP-3, isoform a
MLTGQHHVPGIESPLMVVLWRVAAGVFLPLVPTMAVFGNALVIMSVFRERSLQTVTNMLIVSLAVSDFMVAIGVMSFGVY
YEWNSFKWGLGAFFCHVYQALDVACSTASILNLLAISLDRYIAIGHPISYAQYGARGGRAMISITIVWGVSIAVALPLLL
GVNPMENDMVRPN
Estimated Isoelectric Point:
6.89067840576172
Estimated Molecular Weight:
18.8 kD
Amino Acid Composition:
Amino Acid Frequency
Thr6
Lys1
Gln4
Leu19
Gly14
Met10
Ser13
Tyr6
His4
Glu4
Arg7
Cys2
Phe8
Pro8
Val22
Asn7
Ala17
Ile13
Trp4
Asp4