Sequence:
download
JA60120sequence.fasta
>Cjp-MAB-3, isoform a MLTEDSTPEMCEALIAEQEKNYYCQRCLNHGELNPRKGHKPDCGYLKCPCAECTMVEQRRQLNNLLSKKKVHITPATATK NGKRVRDPHCARCSAHGVLVPLRGHKRTMCQFVTCTCTLCELVEHRRMLMAAQIKLRRLQQKTRDGKEPVKRSGGRKSKN AVEDMEPATVAVQVAEKRADSASPYSSSSSSSSPSTTMSPSLSISPPPTPPPAPLLAPVPVYPSALQMLQHQQQSAQSLF SCLMMNLNCSPIGAIPIEGPHTLTGGGAPPVFSPNSAFTPLVLNEQLGAALATMYLKGLVKIDTRRVP
view sequence (308 aa)
>Cjp-MAB-3, isoform a
MLTEDSTPEMCEALIAEQEKNYYCQRCLNHGELNPRKGHKPDCGYLKCPCAECTMVEQRRQLNNLLSKKKVHITPATATK
NGKRVRDPHCARCSAHGVLVPLRGHKRTMCQFVTCTCTLCELVEHRRMLMAAQIKLRRLQQKTRDGKEPVKRSGGRKSKN
AVEDMEPATVAVQVAEKRADSASPYSSSSSSSSPSTTMSPSLSISPPPTPPPAPLLAPVPVYPSALQMLQHQQQSAQSLF
SCLMMNLNCSPIGAIPIEGPHTLTGGGAPPVFSPNSAFTPLVLNEQLGAALATMYLKGLVKIDTRRVP
Estimated Isoelectric Point:
9.28859710693359
Estimated Molecular Weight:
33.6 kD
Amino Acid Composition:
Amino Acid Frequency
Thr20
Lys19
Gln16
Leu30
Gly16
Met12
Ser27
Tyr6
His9
Glu16
Arg19
Cys15
Phe4
Pro30
Val18
Asn11
Ala25
Ile8
Asp7