Sequence:
download
JA60049sequence.fasta
>Cjp-RAD-54.B MIRKTGKAQESAKSGPNLVHSCLIVVPSSLVNNWKAEFDKWWRFMRFPAVIALQAKDISTYQSTAKSMPYLIVSYDMAQR HVEKLRSQKFDVIVCDEGHKLKNVDGKLRSALVSLQIPRRLILTGTPMQNDYDEFYSLLDFVCPEEFGTLGEFRRMCNEN PEALNRKIDECMLRRTSADVNTSHMPEKHEYILFCAASKIQKRIHSEICEYMTGDALSLIFFARQLVNHPKLLYDNLREK HDKSNQKHSALLLAFDGETMPRGGVKESGKLTALVDMLKCFRLLGECAVIVSNYIETLDMIEQLCKFLEFNIFRLDGKTQ VQDRQKAVRQFNDQRDASNVFLLSTKAGGVGLNLIGASRLVLFDSDWNPANDQQAMARIWRDGQVRPCHIYRLITTGTIE EKMLQRQIKKTGLRCVIDAIEVGDTISTFADEELKDIFTFIEATECNTHDLCECPCDGSGMMENEMAEEEDEEEEEDVEN RKIQKGQQDSDDDEEVDDEELESEITLLEHDDEVVEDSADEKDEDDQEKDLKKHEEPIKTKKNAKTLGVASLAELSRWRH FSPRHQDTWRHFMINSGLSQVETDVQLTFAFYQQSQY
view sequence (597 aa)
>Cjp-RAD-54.B
MIRKTGKAQESAKSGPNLVHSCLIVVPSSLVNNWKAEFDKWWRFMRFPAVIALQAKDISTYQSTAKSMPYLIVSYDMAQR
HVEKLRSQKFDVIVCDEGHKLKNVDGKLRSALVSLQIPRRLILTGTPMQNDYDEFYSLLDFVCPEEFGTLGEFRRMCNEN
PEALNRKIDECMLRRTSADVNTSHMPEKHEYILFCAASKIQKRIHSEICEYMTGDALSLIFFARQLVNHPKLLYDNLREK
HDKSNQKHSALLLAFDGETMPRGGVKESGKLTALVDMLKCFRLLGECAVIVSNYIETLDMIEQLCKFLEFNIFRLDGKTQ
VQDRQKAVRQFNDQRDASNVFLLSTKAGGVGLNLIGASRLVLFDSDWNPANDQQAMARIWRDGQVRPCHIYRLITTGTIE
EKMLQRQIKKTGLRCVIDAIEVGDTISTFADEELKDIFTFIEATECNTHDLCECPCDGSGMMENEMAEEEDEEEEEDVEN
RKIQKGQQDSDDDEEVDDEELESEITLLEHDDEVVEDSADEKDEDDQEKDLKKHEEPIKTKKNAKTLGVASLAELSRWRH
FSPRHQDTWRHFMINSGLSQVETDVQLTFAFYQQSQY
Estimated Isoelectric Point:
5.02767181396484
Estimated Molecular Weight:
68.6 kD
Amino Acid Composition:
Amino Acid Frequency
Thr29
Lys41
Gln31
Leu56
Gly27
Met18
Ser37
Tyr12
His16
Glu57
Arg34
Cys16
Phe26
Pro16
Val33
Asn24
Ala35
Ile33
Trp7
Asp49