Sequence:
download
JA58619sequence.fasta
>Cjp-GPA-16 MGCVWSHQDEAASRSKKIDKLLKEDADSKNRVVKLLLLGAGESGKSTILKQMRIIHDVGYTTEERKVFRAVVYGNIILSL TTLIRAMEQLKISFASVDHESDARKLLMFSTTGEEDELPEELVVLMKSVWSDTGIQRALERAREYQLNDSAPYYLSQLDR ICAPNYIPTQDDILRTRIKTTGIVETQFIYKDRLFLVFDVGGQRSERKKWIHCFEYVTALIFCVALSEYDMVLVEDCKTN RMRESLKLFDSICNNKFFTETSIILFLNKKDLFEEKIQKSPLTHCFPEYTGGNNYEESSAYIQQQFELVNKRTSGQKEIY TQFTCATDTNNIRFVFDAVTDIIIRDNLRTCGLY
view sequence (354 aa)
>Cjp-GPA-16
MGCVWSHQDEAASRSKKIDKLLKEDADSKNRVVKLLLLGAGESGKSTILKQMRIIHDVGYTTEERKVFRAVVYGNIILSL
TTLIRAMEQLKISFASVDHESDARKLLMFSTTGEEDELPEELVVLMKSVWSDTGIQRALERAREYQLNDSAPYYLSQLDR
ICAPNYIPTQDDILRTRIKTTGIVETQFIYKDRLFLVFDVGGQRSERKKWIHCFEYVTALIFCVALSEYDMVLVEDCKTN
RMRESLKLFDSICNNKFFTETSIILFLNKKDLFEEKIQKSPLTHCFPEYTGGNNYEESSAYIQQQFELVNKRTSGQKEIY
TQFTCATDTNNIRFVFDAVTDIIIRDNLRTCGLY
Estimated Isoelectric Point:
5.88825225830078
Estimated Molecular Weight:
40.9 kD
Amino Acid Composition:
Amino Acid Frequency
Thr26
Lys25
Gln15
Leu35
Gly15
Met7
Ser24
Tyr14
His5
Glu28
Arg22
Cys9
Phe18
Pro6
Val21
Asn14
Ala17
Ile27
Trp3
Asp23