Sequence:
download
JA57541sequence.fasta
>Cjp-BUS-18 MYGQFRQILRNEGDPRRQYQLRRVRKSADDSRRENVLVLGYGKGILEYVMGVRVRVSGDEIEFGQTALIVMNHRTRLDWM YMWSALYQINPWLITSNKISLKAQLKKLPGAGFGMAAAQFVFLERNAEVDKKSFDDAIDYFKNIEKSYQILLFPEGTDKS EWTTLKSREFAKKNGLRQLDYVLYPRTTGFLHLLNKMRQQDYIEYIYDITIAYPYNIVQSEVDLVLKGASPREVHFHIRK IPISQVPLNEVEAGKWLNDRWTIKEQLLHKFYSEEQPINRQFPVERGDGVWRSWKEPRRHSYVKITALMFWFTVILVCGY HIFFVRTLQIGFAYFFVVSFFLNYLYGGIDKFIISKWQNANNHVSS
view sequence (366 aa)
>Cjp-BUS-18
MYGQFRQILRNEGDPRRQYQLRRVRKSADDSRRENVLVLGYGKGILEYVMGVRVRVSGDEIEFGQTALIVMNHRTRLDWM
YMWSALYQINPWLITSNKISLKAQLKKLPGAGFGMAAAQFVFLERNAEVDKKSFDDAIDYFKNIEKSYQILLFPEGTDKS
EWTTLKSREFAKKNGLRQLDYVLYPRTTGFLHLLNKMRQQDYIEYIYDITIAYPYNIVQSEVDLVLKGASPREVHFHIRK
IPISQVPLNEVEAGKWLNDRWTIKEQLLHKFYSEEQPINRQFPVERGDGVWRSWKEPRRHSYVKITALMFWFTVILVCGY
HIFFVRTLQIGFAYFFVVSFFLNYLYGGIDKFIISKWQNANNHVSS
Estimated Isoelectric Point:
9.51770782470703
Estimated Molecular Weight:
43.3 kD
Amino Acid Composition:
Amino Acid Frequency
Thr13
Lys24
Gln19
Leu33
Gly22
Met8
Ser20
Tyr21
His8
Glu21
Arg27
Cys1
Phe23
Pro12
Val26
Asn17
Ala17
Ile27
Trp10
Asp17