Sequence:
download
JA57260sequence.fasta
>CJA09385, isoform b MLTFIGDALAGPLRARRGSASGQLTMLSTTSPFITSDPGKQNAYCDASANLLTNIFLVDVSDPIIGTIDDKLSKISNFLL NVPSQVNLSSNDDWNGQEFRLVVYGGNEPFPLGRARNQQSWNKVVSELNTTIVNPTKLDGHQMTDALRFVFNNYRPAYGT AGNIIVVGDGFDFDEMESATTISTALKYQYRFSLGFLLMTTSQVQRSVVQPLASDFSHFYPIDSVDYLSNPAVVQTQANW ICSAFYPVPAPPTPPPTRLPLLTTATTAGPLTQTTANPLLPPISSCTQNVLFLIDQSQTLLVNGYNKGYTSLSQFISSIS NAPQTLGNSDAKVGFNEAANFISTKSRYDQDSISSLLYFVTDGNNLDNSVANVQNVTKSIRSRLQTEIIGIDLRETVSNK KNVQNIIQFDVLDGLPESIYVGVSQPDAILDDQIINSTSYKLRCKGSSNCFTGITFVMETSQAEGYNYVDVQKLSIINVL NHYTAPVSVSLVYFSSPDSLDPNNPDRSGILFGQITNSTNAINILNTTNFDLGAASDLELGFTKTLESLNKGYLENNNLV IFFARGAYERLSNCCPDPTAAANAVKQQATVQGVMIGPYSSKSQLDSLTGSNSIDANALIGGNTLNSTQDRLDAADQISD AIIPIIDSFLNNEVCSGIPGYADPPCEDPIDVLVLLHANSLENWNRIKNFTANELLPSLLGETGAVANKQLTTSTPVNFA VASYYYLDVVDHADFTYLLSVEDYQNLLTKISYRETKGTATLSTAYKKAIEIFEDGRPYASKNLILITDTLDISDLEDAF SEHDAMTQLVGGYTTALAINTDIIPGADYQINIDPSQLDSYNRYTRRKLANSLTQNNCVYKPVQVPTLPPVTPSPTLPGP IPLVKARNVWPDITILIDTSKSQENPMNDELFEKIRAFLDILLIQYSVGKHGSRFTVATYDGDTVEYSCIFDQDSYYDLS SCRNERLSLFSRNHENYRNVDGVLSDVLHNVYQNNTSGYRSLNENFLVLFTLGASSTPFTQQLKNIERKGIRTIAIGLSN NISNNDLSQFSRTAFSVPDWSSSFSGIDTNYDLADRIFQITTKKRLPSSSNFFGNLVFIVDQSGNSASDHSNIVQYVTDF VTPYLIDPVKTQISIVPFAGSVISPLSINSSQTEVDSWLDSWKLTTASSDYSANVGSAIQFAASELGSTYDRPTHVVFVL GSANVTGTELAQQLLNGSNLYVASYNIANNTDFNNLVFTSDRIYSVNSSVELLNRVVSLDVTKPNPMLVLDKDILETQEK NDQSSFPTSSIAADVIMLLDETGLEDNEFETMKQFLSNFTQKFSVGSESTQFALQSYNGRTIPHDGFHLYESTSGEVVKN RIQQLTLAKAAENSTDADLAGAIEQEIFFFLTEKNGWREDTTTYTIIFSHADSFYTRDTDTAMGVKNVSSVFSLGVNGMK FDYVQNFTNTGFYETVAGVSALNINAPEVADLLAAINNDYKNLVYPSTHSVKEIVKADFIFLIDSSLGSSKNQAVQQFLL DFTANVGTFSSSGNDTRMAVVVYGKSATTLWNLQNAQDIDSLRNRISQIQITSSSSGTVNLRRAIDSIILNEGDFGVDYN RPEYIIDIASSLTISPTIDTATSRHLNTRYSTFVMQTNNDNSTFSYCSQVLGTKLFTDRVAINPELSFDNSEAQGKLFSW ISNEFSAWSTTFPDKS
view sequence (1696 aa)
>CJA09385, isoform b
MLTFIGDALAGPLRARRGSASGQLTMLSTTSPFITSDPGKQNAYCDASANLLTNIFLVDVSDPIIGTIDDKLSKISNFLL
NVPSQVNLSSNDDWNGQEFRLVVYGGNEPFPLGRARNQQSWNKVVSELNTTIVNPTKLDGHQMTDALRFVFNNYRPAYGT
AGNIIVVGDGFDFDEMESATTISTALKYQYRFSLGFLLMTTSQVQRSVVQPLASDFSHFYPIDSVDYLSNPAVVQTQANW
ICSAFYPVPAPPTPPPTRLPLLTTATTAGPLTQTTANPLLPPISSCTQNVLFLIDQSQTLLVNGYNKGYTSLSQFISSIS
NAPQTLGNSDAKVGFNEAANFISTKSRYDQDSISSLLYFVTDGNNLDNSVANVQNVTKSIRSRLQTEIIGIDLRETVSNK
KNVQNIIQFDVLDGLPESIYVGVSQPDAILDDQIINSTSYKLRCKGSSNCFTGITFVMETSQAEGYNYVDVQKLSIINVL
NHYTAPVSVSLVYFSSPDSLDPNNPDRSGILFGQITNSTNAINILNTTNFDLGAASDLELGFTKTLESLNKGYLENNNLV
IFFARGAYERLSNCCPDPTAAANAVKQQATVQGVMIGPYSSKSQLDSLTGSNSIDANALIGGNTLNSTQDRLDAADQISD
AIIPIIDSFLNNEVCSGIPGYADPPCEDPIDVLVLLHANSLENWNRIKNFTANELLPSLLGETGAVANKQLTTSTPVNFA
VASYYYLDVVDHADFTYLLSVEDYQNLLTKISYRETKGTATLSTAYKKAIEIFEDGRPYASKNLILITDTLDISDLEDAF
SEHDAMTQLVGGYTTALAINTDIIPGADYQINIDPSQLDSYNRYTRRKLANSLTQNNCVYKPVQVPTLPPVTPSPTLPGP
IPLVKARNVWPDITILIDTSKSQENPMNDELFEKIRAFLDILLIQYSVGKHGSRFTVATYDGDTVEYSCIFDQDSYYDLS
SCRNERLSLFSRNHENYRNVDGVLSDVLHNVYQNNTSGYRSLNENFLVLFTLGASSTPFTQQLKNIERKGIRTIAIGLSN
NISNNDLSQFSRTAFSVPDWSSSFSGIDTNYDLADRIFQITTKKRLPSSSNFFGNLVFIVDQSGNSASDHSNIVQYVTDF
VTPYLIDPVKTQISIVPFAGSVISPLSINSSQTEVDSWLDSWKLTTASSDYSANVGSAIQFAASELGSTYDRPTHVVFVL
GSANVTGTELAQQLLNGSNLYVASYNIANNTDFNNLVFTSDRIYSVNSSVELLNRVVSLDVTKPNPMLVLDKDILETQEK
NDQSSFPTSSIAADVIMLLDETGLEDNEFETMKQFLSNFTQKFSVGSESTQFALQSYNGRTIPHDGFHLYESTSGEVVKN
RIQQLTLAKAAENSTDADLAGAIEQEIFFFLTEKNGWREDTTTYTIIFSHADSFYTRDTDTAMGVKNVSSVFSLGVNGMK
FDYVQNFTNTGFYETVAGVSALNINAPEVADLLAAINNDYKNLVYPSTHSVKEIVKADFIFLIDSSLGSSKNQAVQQFLL
DFTANVGTFSSSGNDTRMAVVVYGKSATTLWNLQNAQDIDSLRNRISQIQITSSSSGTVNLRRAIDSIILNEGDFGVDYN
RPEYIIDIASSLTISPTIDTATSRHLNTRYSTFVMQTNNDNSTFSYCSQVLGTKLFTDRVAINPELSFDNSEAQGKLFSW
ISNEFSAWSTTFPDKS
Estimated Isoelectric Point:
4.59091949462891
Estimated Molecular Weight:
186.3 kD
Amino Acid Composition:
Amino Acid Frequency
Thr142
Lys56
Gln77
Leu158
Gly87
Met16
Ser187
Tyr65
His16
Glu60
Arg55
Cys13
Phe85
Pro73
Val114
Asn140
Ala109
Ile113
Trp12
Asp118