Sequence:
download
JA56487sequence.fasta
>Cjp-BUS-8 MHVVIVHPEQWNGGSDRCTVALIRHFVSQGHRVTWLTTMIDEYWKNHKFDGVEIREVGLKLHPGDWWSQNVALGWHMVFS NLNPDVAIIDHSASCVPMIKWRFPECKILFYCHFPQQLVTPSRFFLYRWYAKLIGIVEEELFGHIDQIFVNSNFTATQFC KVMPNIDKSKVRVVYPPCDIDWIVSASERPVSRAQRARNNDYTFLSMNRFWPEKRLDIIVEAAAILKRQGYKLHVQLAGS VMPHIPESRIYYELLQKMTEDLDVNDIVEFIPSPTDKVKFELYQKCDTALYTPPNEHFGIVPIEALDQRRPVIVCDSGGP AETVLENVTGTKIAKPCGELLAEAMLFHMNKREWPELDTEEGYAKQRQRLEKEFSTRGFCANIDRAIAEMFGSIDITDEQ TTTPAQTTIVTQPVATEVYSKPQQYNKAAHNRRAQA
view sequence (436 aa)
>Cjp-BUS-8
MHVVIVHPEQWNGGSDRCTVALIRHFVSQGHRVTWLTTMIDEYWKNHKFDGVEIREVGLKLHPGDWWSQNVALGWHMVFS
NLNPDVAIIDHSASCVPMIKWRFPECKILFYCHFPQQLVTPSRFFLYRWYAKLIGIVEEELFGHIDQIFVNSNFTATQFC
KVMPNIDKSKVRVVYPPCDIDWIVSASERPVSRAQRARNNDYTFLSMNRFWPEKRLDIIVEAAAILKRQGYKLHVQLAGS
VMPHIPESRIYYELLQKMTEDLDVNDIVEFIPSPTDKVKFELYQKCDTALYTPPNEHFGIVPIEALDQRRPVIVCDSGGP
AETVLENVTGTKIAKPCGELLAEAMLFHMNKREWPELDTEEGYAKQRQRLEKEFSTRGFCANIDRAIAEMFGSIDITDEQ
TTTPAQTTIVTQPVATEVYSKPQQYNKAAHNRRAQA
Estimated Isoelectric Point:
6.21883392333984
Estimated Molecular Weight:
50.3 kD
Amino Acid Composition:
Amino Acid Frequency
Thr25
Lys23
Gln21
Leu28
Gly19
Met11
Ser20
Tyr14
His15
Glu31
Arg25
Cys10
Phe21
Pro26
Val35
Asn18
Ala29
Ile31
Trp11
Asp23