Sequence:
download
JA56451sequence.fasta
>Cjp-SUP-12 MCPLGFPTLGLLVSVHFFRFLCITPKISSSKMYGQVQDPLVHAAAAALAQSTNADPVVGSRDTMFTKIFVGGLPYHTSDK TLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRTSAERACKDPNPIIDGRKANVNLAYLGAKPRTNVQLAALAAGQ VQLPLTTQLQALFPPRIG
view sequence (178 aa)
>Cjp-SUP-12
MCPLGFPTLGLLVSVHFFRFLCITPKISSSKMYGQVQDPLVHAAAAALAQSTNADPVVGSRDTMFTKIFVGGLPYHTSDK
TLHEYFEQFGDIEEAVVITDRNTQKSRGYGFVTMKDRTSAERACKDPNPIIDGRKANVNLAYLGAKPRTNVQLAALAAGQ
VQLPLTTQLQALFPPRIG
Estimated Isoelectric Point:
9.05083465576172
Estimated Molecular Weight:
19.4 kD
Amino Acid Composition:
Amino Acid Frequency
Thr14
Lys9
Gln10
Leu17
Gly13
Met4
Ser9
Tyr5
His4
Glu5
Arg9
Cys3
Phe10
Pro12
Val13
Asn6
Ala18
Ile8
Asp9