Sequence:
download
JA55787sequence.fasta
>Cjp-KLP-11 MVEIMKKSSKQETVKVIVRCRPLSAQEKENGHSKIVHMRTQVGQIELRNPKDHEDTKDFTFDAIYDENSTQSDLYEETFR DLVDSVLNGYNATIFAYGQTGTGKTHTMEGKSDDPQQRGVIYKCIEHIFEHMAASHNQEEYLVRASYLEIYQEEIRDLLE AESNKKLEIKERPDGGVYVKDLTSRLTRSIAEIQDVMIRGNAHRSVGRTNMNEHSSRSHAIFMITVECSRIGADGESHIT VGRLNLVDLAGSERQSKTGATGDRFKEATKINLSLSALGNVIKALVDAKSAHVPYRDSKLTRLLQDSLGGNSKTVMVACI GPASYNYEETIGTLRYANRAKNIKNKPKINEDPKDALIREFQEEIENLKKKLAERKLRSGGKTANSQSYYDAEREKLEND MEAIQADDSLIKQEKEKLLREISSVDLRLPGVDLRKV
view sequence (437 aa)
>Cjp-KLP-11
MVEIMKKSSKQETVKVIVRCRPLSAQEKENGHSKIVHMRTQVGQIELRNPKDHEDTKDFTFDAIYDENSTQSDLYEETFR
DLVDSVLNGYNATIFAYGQTGTGKTHTMEGKSDDPQQRGVIYKCIEHIFEHMAASHNQEEYLVRASYLEIYQEEIRDLLE
AESNKKLEIKERPDGGVYVKDLTSRLTRSIAEIQDVMIRGNAHRSVGRTNMNEHSSRSHAIFMITVECSRIGADGESHIT
VGRLNLVDLAGSERQSKTGATGDRFKEATKINLSLSALGNVIKALVDAKSAHVPYRDSKLTRLLQDSLGGNSKTVMVACI
GPASYNYEETIGTLRYANRAKNIKNKPKINEDPKDALIREFQEEIENLKKKLAERKLRSGGKTANSQSYYDAEREKLEND
MEAIQADDSLIKQEKEKLLREISSVDLRLPGVDLRKV
Estimated Isoelectric Point:
6.49771881103516
Estimated Molecular Weight:
49.4 kD
Amino Acid Composition:
Amino Acid Frequency
Thr24
Lys37
Gln17
Leu35
Gly26
Met10
Ser34
Tyr15
His12
Glu42
Arg30
Cys4
Phe8
Pro9
Val25
Asn22
Ala29
Ile30
Asp28