Sequence:
download
JA55010sequence.fasta
>Cjp-HIM-18 MHFEAITLSDDDDDEVAATSTKSLTKPTKPNKCSICQRSMDLWSNSRIEIHTKVCQMKRDKEKEKEKEKKAPKSKFQPEY VRIEEPIDTRARKRPRSYAVVELAPKKCKCEVVATLHSRFLDEFHFSSVKMRKTREQGVSEHAFQMRRLIEKLSRYEQLS RDMHKVLDSAASPSSTSNPNITLKCTDGDVTCPVLVLTHRTSLVKSPPAPIQIDKRVEVVKTWLTYVFTANIEWNDEQRE DVMELARKYGPVGLENVLEVNAGAVVREEREEEEEKEEEKPNEDVEEELGVTKETETEVEKTPEKCVFTSDDPLVNFGKL ASTPPHCTVTPTLDSFDEWSNQSVHHRSTITTLTPPAAHAASDSAPNPNTKPVFGSNVRILKTDSITPLPIFDEMDEAEL KERMKQIGMRAKGKSVMIQLLKKAYTTLHPEVLPETPTLRPLVERRRRSAKRSPKLALNERLRSSDNEEQGGEEEDEDEE EEEGEAGLSNIDTNELQSAFLAWLRSDANSMLHEHILSLQPVSLEEMLIRLEKADGPLGRIGKAKLARLLDSLQINFQQP QKCAGVRRINRAFKKRF
view sequence (577 aa)
>Cjp-HIM-18
MHFEAITLSDDDDDEVAATSTKSLTKPTKPNKCSICQRSMDLWSNSRIEIHTKVCQMKRDKEKEKEKEKKAPKSKFQPEY
VRIEEPIDTRARKRPRSYAVVELAPKKCKCEVVATLHSRFLDEFHFSSVKMRKTREQGVSEHAFQMRRLIEKLSRYEQLS
RDMHKVLDSAASPSSTSNPNITLKCTDGDVTCPVLVLTHRTSLVKSPPAPIQIDKRVEVVKTWLTYVFTANIEWNDEQRE
DVMELARKYGPVGLENVLEVNAGAVVREEREEEEEKEEEKPNEDVEEELGVTKETETEVEKTPEKCVFTSDDPLVNFGKL
ASTPPHCTVTPTLDSFDEWSNQSVHHRSTITTLTPPAAHAASDSAPNPNTKPVFGSNVRILKTDSITPLPIFDEMDEAEL
KERMKQIGMRAKGKSVMIQLLKKAYTTLHPEVLPETPTLRPLVERRRRSAKRSPKLALNERLRSSDNEEQGGEEEDEDEE
EEEGEAGLSNIDTNELQSAFLAWLRSDANSMLHEHILSLQPVSLEEMLIRLEKADGPLGRIGKAKLARLLDSLQINFQQP
QKCAGVRRINRAFKKRF
Estimated Isoelectric Point:
5.85727691650391
Estimated Molecular Weight:
65.7 kD
Amino Acid Composition:
Amino Acid Frequency
Thr39
Lys49
Gln18
Leu50
Gly18
Met13
Ser44
Tyr6
His14
Glu69
Arg41
Cys10
Phe16
Pro35
Val38
Asn21
Ala36
Ile23
Trp5
Asp32