Sequence:
download
JA54960sequence.fasta
>Cjp-PHA-4 MEKSEKLSASDEELLLMKVIKEEEVSEESEEEEEEEDVTTEATTTTDDEEVEQKAEDEVKENKEDGGEKASVKKQHKMLQ NSGDAASAPTLPTSSSSLEYSAMNVGDYQPTYSNSVAAATLNYPYYGTTTNSQLNYNYSNYGTANQILPNFGSAANFMQP GGISPIGFSNTPATAVTSNSSTSTLPRSSRTSSSANSTLNAAAGSPGERNYGGSGQELTVQEFENVREKIRRHGTYGSSK PPYSYISLITMAIQKSTTRQLTLSEIYNWIMELFPYYQNNQQRWQNSIRHSLSFNDCFVKVPRSPDKPGKGSFWTLHEHC GNMFENGCYLRRQKRFKVKEREPSRKKRNAAANNHNQNQAPKVEVKQEEDPTSSSQNLVANYQQMALNAVKDVKEEMKPE TVSSVVIDPSLSTLGSTSSALQSNQATSVISSVGTLGTTQPQLNMNTQYSPYLYSTTDFSSNLLLPPFPTNPLYNTTGSY TINDYAGYQNTLYSSTNPNSAANL
view sequence (504 aa)
>Cjp-PHA-4
MEKSEKLSASDEELLLMKVIKEEEVSEESEEEEEEEDVTTEATTTTDDEEVEQKAEDEVKENKEDGGEKASVKKQHKMLQ
NSGDAASAPTLPTSSSSLEYSAMNVGDYQPTYSNSVAAATLNYPYYGTTTNSQLNYNYSNYGTANQILPNFGSAANFMQP
GGISPIGFSNTPATAVTSNSSTSTLPRSSRTSSSANSTLNAAAGSPGERNYGGSGQELTVQEFENVREKIRRHGTYGSSK
PPYSYISLITMAIQKSTTRQLTLSEIYNWIMELFPYYQNNQQRWQNSIRHSLSFNDCFVKVPRSPDKPGKGSFWTLHEHC
GNMFENGCYLRRQKRFKVKEREPSRKKRNAAANNHNQNQAPKVEVKQEEDPTSSSQNLVANYQQMALNAVKDVKEEMKPE
TVSSVVIDPSLSTLGSTSSALQSNQATSVISSVGTLGTTQPQLNMNTQYSPYLYSTTDFSSNLLLPPFPTNPLYNTTGSY
TINDYAGYQNTLYSSTNPNSAANL
Estimated Isoelectric Point:
5.06932830810547
Estimated Molecular Weight:
55.6 kD
Amino Acid Composition:
Amino Acid Frequency
Thr45
Lys27
Gln28
Leu34
Gly26
Met11
Ser66
Tyr26
His6
Glu43
Arg16
Cys3
Phe12
Pro28
Val24
Asn44
Ala33
Ile14
Trp3
Asp15