Sequence:
download
JA54705sequence.fasta
>Cjp-BUS-12 MTKIMVTRFFFDYPVVILMMQSAATLFVIEVSRVIGILKVAPYCFEKGRHIVVPSILYAMSLWITVGSFEGIAMPNFDPV KRLTPILILVGLAVRSRTQKLDQNRCLIIVGLAIASSVAVNLDFSIDRYSFFYGFSGAILQAIALILFEEHLQNYSYTEV LYMHSFNSLVFYLLADIIRDELRDAFMYMITAAHPLFIIVFIISMIAGIILQFSAFSCLEKNGALNIQIVSNVRAVAETF IAYYLSIYLFYDVYIGVINWIFLAVTIVAARLLCSRDSEPDLVKP
view sequence (285 aa)
>Cjp-BUS-12
MTKIMVTRFFFDYPVVILMMQSAATLFVIEVSRVIGILKVAPYCFEKGRHIVVPSILYAMSLWITVGSFEGIAMPNFDPV
KRLTPILILVGLAVRSRTQKLDQNRCLIIVGLAIASSVAVNLDFSIDRYSFFYGFSGAILQAIALILFEEHLQNYSYTEV
LYMHSFNSLVFYLLADIIRDELRDAFMYMITAAHPLFIIVFIISMIAGIILQFSAFSCLEKNGALNIQIVSNVRAVAETF
IAYYLSIYLFYDVYIGVINWIFLAVTIVAARLLCSRDSEPDLVKP
Estimated Isoelectric Point:
6.41803741455078
Estimated Molecular Weight:
32.2 kD
Amino Acid Composition:
Amino Acid Frequency
Thr10
Lys7
Gln7
Leu32
Gly11
Met10
Ser21
Tyr15
His4
Glu10
Arg13
Cys4
Phe22
Pro9
Val27
Asn9
Ala25
Ile36
Trp2
Asp11