Sequence:
download
JA54625sequence.fasta
>Cjp-EPS-8 MCICVSTLLAFCCGDADTNLTENQYFSLHFSRGQPGYYYSRSSTASQQAPSPSHSQHSQAHPSSQSSKAPMSQPIVRRSA ADYRSGSEQMTPRSDHRGPSAYGNGGVDARLDDVTPSYFVEHLATFAVGRQFGLTVPADGIRKLKQMEKNSAIWAQPLIL RFRHNAVTVEDDNGELVEQFPLELIENPTAHVSNDARDTYNNILLFVVREDRKRMSTPTEMHIFQCIRVSATEVADDLQA FSRGQYRRVRNGRRTNAPTHLQAQQQQMPFYPPDDASISSETSEMFERDVNTLNRCFDDIERFVARIQSAALAQREIEQQ NYRYRTANRRDKKNQQPPDPNGILFMRAQLPIESEFVDILKKFKLSFNLLAKLKNHIHEPNAPELLHFLFTPLSVILEAC HWGLGRNIAPTVASPLLSLEARELMQNCLTSRESDIWISLGDAWRTPPEDWTKPLPPPYRPIFLDGFAPYGVADRVITTP NPLHRGQSAPPEHYRQPPRERERNAVDTAPSTPQTTARTTTPKSRPHRNMSVDNLEFDRLTLERERLEFEKAKIMERENR LRHEEKQIEDEKRRLHAEKDLIKKETLTDTLPPITKRYDPPISTSPTPRNSGYSHVKVTVDSDTSPRQQSFIDDIVGRGG KLAVVTYDRGGQNPKELTVHKGEYLEVLFDERNWWECKNMHQRIGYVPHTILSIVPFEQQQYAVSFKPTSTGLYFIQKSP YSHPTTTIPPRTHSTCSTTDSNSTSPDQVCYPKTRHPT
view sequence (758 aa)
>Cjp-EPS-8
MCICVSTLLAFCCGDADTNLTENQYFSLHFSRGQPGYYYSRSSTASQQAPSPSHSQHSQAHPSSQSSKAPMSQPIVRRSA
ADYRSGSEQMTPRSDHRGPSAYGNGGVDARLDDVTPSYFVEHLATFAVGRQFGLTVPADGIRKLKQMEKNSAIWAQPLIL
RFRHNAVTVEDDNGELVEQFPLELIENPTAHVSNDARDTYNNILLFVVREDRKRMSTPTEMHIFQCIRVSATEVADDLQA
FSRGQYRRVRNGRRTNAPTHLQAQQQQMPFYPPDDASISSETSEMFERDVNTLNRCFDDIERFVARIQSAALAQREIEQQ
NYRYRTANRRDKKNQQPPDPNGILFMRAQLPIESEFVDILKKFKLSFNLLAKLKNHIHEPNAPELLHFLFTPLSVILEAC
HWGLGRNIAPTVASPLLSLEARELMQNCLTSRESDIWISLGDAWRTPPEDWTKPLPPPYRPIFLDGFAPYGVADRVITTP
NPLHRGQSAPPEHYRQPPRERERNAVDTAPSTPQTTARTTTPKSRPHRNMSVDNLEFDRLTLERERLEFEKAKIMERENR
LRHEEKQIEDEKRRLHAEKDLIKKETLTDTLPPITKRYDPPISTSPTPRNSGYSHVKVTVDSDTSPRQQSFIDDIVGRGG
KLAVVTYDRGGQNPKELTVHKGEYLEVLFDERNWWECKNMHQRIGYVPHTILSIVPFEQQQYAVSFKPTSTGLYFIQKSP
YSHPTTTIPPRTHSTCSTTDSNSTSPDQVCYPKTRHPT
Estimated Isoelectric Point:
7.95377349853516
Estimated Molecular Weight:
86.5 kD
Amino Acid Composition:
Amino Acid Frequency
Thr57
Lys30
Gln42
Leu56
Gly30
Met13
Ser61
Tyr24
His26
Glu49
Arg64
Cys11
Phe30
Pro63
Val37
Asn33
Ala47
Ile35
Trp7
Asp43