Sequence:
download
JA54613sequence.fasta
>Cjp-HIM-3 MPAMTTTSRPTSKSRDSVTQQNASWSTTFPVELEIEKSSSTFAFRFIKCTTSFILDKRSLLSDTCFKTRTIEKLLVPCFK QDNVTAQRLSEKLDGLKAAISSRYLKEFAVVFYRQPDEEDVIEVYNFRLMYSEDGDVALSMDTGFGREEDSQNLINAKFT SLEDTKKQFVDALKKLHRCMKGLENIPEDADASFRISFTEGTPKDYMPKGFDGSSEFFHIDSRSVQLGIVCGGYHKVQML AASLLLKPGRVTEDLNKTSYSGNQSLVEAPTPKKATSKISPKKKRIHPYGHTGSLERRNNV
view sequence (301 aa)
>Cjp-HIM-3
MPAMTTTSRPTSKSRDSVTQQNASWSTTFPVELEIEKSSSTFAFRFIKCTTSFILDKRSLLSDTCFKTRTIEKLLVPCFK
QDNVTAQRLSEKLDGLKAAISSRYLKEFAVVFYRQPDEEDVIEVYNFRLMYSEDGDVALSMDTGFGREEDSQNLINAKFT
SLEDTKKQFVDALKKLHRCMKGLENIPEDADASFRISFTEGTPKDYMPKGFDGSSEFFHIDSRSVQLGIVCGGYHKVQML
AASLLLKPGRVTEDLNKTSYSGNQSLVEAPTPKKATSKISPKKKRIHPYGHTGSLERRNNV
Estimated Isoelectric Point:
8.80025482177734
Estimated Molecular Weight:
33.9 kD
Amino Acid Composition:
Amino Acid Frequency
Thr24
Lys27
Gln10
Leu25
Gly15
Met7
Ser32
Tyr8
His5
Glu20
Arg17
Cys5
Phe18
Pro13
Val16
Asn10
Ala16
Ile13
Trp1
Asp19