Sequence:
download
JA53802sequence.fasta
>Cjp-ZYG-12, isoform a MIDLTNSDGGTSSDNANSSHHRYGTDSMDSDGPGRSSSRRFVVADEPTIQQNRMDLADLAIWLSGLKATEFPLDNPHDLC NGRAFAELLHEIDKDFFDSDWLDKMPMLTTPTNIVVKRSNLRRLWRKISDYITDQLHRKLPTACRWTEISERVDGFEESD LPVAVDLGMIVVTLAHIGRTQETYVQYSQSLSSKYQREIANVARMISLVMEEFPETLSGLDVSLLDESAHEQKEICMQES TSHAADGKTSRRHTLSNSESLLEAQRESHCKEKDQLLREVDRLTKALDAALLNATPSTETNVDVSLLERQNEKLRFKKRE IEERFHELEAQIEQHRLNLKDLTEENDKLRSGHKDLNLVRSELHSARDAVEEWRAKATKYSEEVEVMKKRKEKEVKDLEL KLDFMNSRIENFVKESTISEDNKKTMDIMRSKIGTLEANIDQMQRQEVSKSHMVNELENKLIEYKERVNELNERKDELVA ERNLLQEQLALIQNIVQQLQKGAELLPSPFSEKPQELPQEITIKRLRERIQELETLEPLQGEIIILKSRIGVLEEENLVL SKRKEDLQREVNEYKEKELEKSQKLHVSNDVLELKVQIEKANVELERLREVQARGESRSADLESLVELRTRELEKEKDLL FKAKQIIDELELRSRPVGEDSITSVQQFKELQEENEQLREKVERLAIELHNVSSSLDHENRLFNSAAHQMVLNRSIDDAT PTRTRAGADSVPPQTLLETQKMSGALPWRYT
view sequence (751 aa)
>Cjp-ZYG-12, isoform a
MIDLTNSDGGTSSDNANSSHHRYGTDSMDSDGPGRSSSRRFVVADEPTIQQNRMDLADLAIWLSGLKATEFPLDNPHDLC
NGRAFAELLHEIDKDFFDSDWLDKMPMLTTPTNIVVKRSNLRRLWRKISDYITDQLHRKLPTACRWTEISERVDGFEESD
LPVAVDLGMIVVTLAHIGRTQETYVQYSQSLSSKYQREIANVARMISLVMEEFPETLSGLDVSLLDESAHEQKEICMQES
TSHAADGKTSRRHTLSNSESLLEAQRESHCKEKDQLLREVDRLTKALDAALLNATPSTETNVDVSLLERQNEKLRFKKRE
IEERFHELEAQIEQHRLNLKDLTEENDKLRSGHKDLNLVRSELHSARDAVEEWRAKATKYSEEVEVMKKRKEKEVKDLEL
KLDFMNSRIENFVKESTISEDNKKTMDIMRSKIGTLEANIDQMQRQEVSKSHMVNELENKLIEYKERVNELNERKDELVA
ERNLLQEQLALIQNIVQQLQKGAELLPSPFSEKPQELPQEITIKRLRERIQELETLEPLQGEIIILKSRIGVLEEENLVL
SKRKEDLQREVNEYKEKELEKSQKLHVSNDVLELKVQIEKANVELERLREVQARGESRSADLESLVELRTRELEKEKDLL
FKAKQIIDELELRSRPVGEDSITSVQQFKELQEENEQLREKVERLAIELHNVSSSLDHENRLFNSAAHQMVLNRSIDDAT
PTRTRAGADSVPPQTLLETQKMSGALPWRYT
Estimated Isoelectric Point:
5.20294952392578
Estimated Molecular Weight:
86.8 kD
Amino Acid Composition:
Amino Acid Frequency
Thr37
Lys53
Gln39
Leu93
Gly21
Met17
Ser62
Tyr9
His19
Glu97
Arg58
Cys4
Phe15
Pro20
Val42
Asn35
Ala40
Ile36
Trp6
Asp48