Sequence:
download
JA51287sequence.fasta
>Cjp-HIM-14 MYSNRSLLRRQRQDASSTAETSASRSEDRFSSSLIRLKGQSHNETSGNNTTSKNVHSVVIVIMEGRGGAEGRIGVAMHDV RYPEVNLCEFVDSREFTTLKTMINVHEAYDIVIQSGNEERGTTKLLGEALMTAFPEASLQSISAKYFNSDRGERQLRSLM NLEISTVSEGCFRRTLALGALAVLLKYIHETRFVFFRIKSLRIREMGVDDTCMIDFVSWESLEIVDTDDASKARKHQMKQ KRTLMSVLNHTVTTNGYRLLRSNVLQPSTDVVTIESRQEAIEELIAQPQLKEKLRRTLSRAHELDRVIAMCIQTSSSWTV RESEAKINQIIKLMQTLKVIQGIRTLLDSANVKSQLLIEKTEDTRFEQIMQILMEKVDDSMLDGRKNSLHLQNTKCYAIR DFVAVQLDLARQTYEELVSQVEQTGAREIAEHFHNNPAVRLSFSQQRGFHYTLVTRQAESVTIPRNFMEVFRNRNTVTFN SRSVIAYNDRLEQVVSEMFLASDVIVCDMIELMQPVIPVLYYAMDALSTIDFLCGLATYSDLRDTCRPAFGQSFSVSQGR HPILDWADTEKTITNDILTSTSTSNGAFFQLKMLHLQRRLHHQVPAAAPHGNSARRRPSAPIDWSNLGAAANRQLDNCYS RSIDVIVSQFRPAQPCLTRDRRFGIITGPNMAGKSTYIKQAAQLAIIAQIGCFIPANYATMPIFTRIFSRMGHNDELVRN KSAFACEMSDAASIVQYADRNSLVVLDELARSTSAEEGVAITYAICERILSLQSYTFLATHFLDIAALANFSHAIEKYGV FQD
view sequence (803 aa)
>Cjp-HIM-14
MYSNRSLLRRQRQDASSTAETSASRSEDRFSSSLIRLKGQSHNETSGNNTTSKNVHSVVIVIMEGRGGAEGRIGVAMHDV
RYPEVNLCEFVDSREFTTLKTMINVHEAYDIVIQSGNEERGTTKLLGEALMTAFPEASLQSISAKYFNSDRGERQLRSLM
NLEISTVSEGCFRRTLALGALAVLLKYIHETRFVFFRIKSLRIREMGVDDTCMIDFVSWESLEIVDTDDASKARKHQMKQ
KRTLMSVLNHTVTTNGYRLLRSNVLQPSTDVVTIESRQEAIEELIAQPQLKEKLRRTLSRAHELDRVIAMCIQTSSSWTV
RESEAKINQIIKLMQTLKVIQGIRTLLDSANVKSQLLIEKTEDTRFEQIMQILMEKVDDSMLDGRKNSLHLQNTKCYAIR
DFVAVQLDLARQTYEELVSQVEQTGAREIAEHFHNNPAVRLSFSQQRGFHYTLVTRQAESVTIPRNFMEVFRNRNTVTFN
SRSVIAYNDRLEQVVSEMFLASDVIVCDMIELMQPVIPVLYYAMDALSTIDFLCGLATYSDLRDTCRPAFGQSFSVSQGR
HPILDWADTEKTITNDILTSTSTSNGAFFQLKMLHLQRRLHHQVPAAAPHGNSARRRPSAPIDWSNLGAAANRQLDNCYS
RSIDVIVSQFRPAQPCLTRDRRFGIITGPNMAGKSTYIKQAAQLAIIAQIGCFIPANYATMPIFTRIFSRMGHNDELVRN
KSAFACEMSDAASIVQYADRNSLVVLDELARSTSAEEGVAITYAICERILSLQSYTFLATHFLDIAALANFSHAIEKYGV
FQD
Estimated Isoelectric Point:
7.60962677001953
Estimated Molecular Weight:
90.7 kD
Amino Acid Composition:
Amino Acid Frequency
Thr55
Lys27
Gln43
Leu72
Gly32
Met25
Ser73
Tyr20
His20
Glu50
Arg65
Cys13
Phe34
Pro19
Val52
Asn36
Ala66
Ile56
Trp4
Asp41