Sequence:
download
JA51043sequence.fasta
>Cjp-MAB-3, isoform b MNATVSPAALLLRAHRREKRLFVCLCPQKKEHKKSRKEELMLTEDSTPEMCEALIAEQEKNYYCQRCLNHGELNPRKGHK PDCGYLKCPCAECTMVEQRRQLNNLLSKKKVHITPATATKNGKRVRDPHCARCSAHGVLVPLRGHKRTMCQFVTCTCTLC ELVEHRRMLMAAQIKLRRLQQKTRDGKEPVKRSGGRKSKNAVEDMEPATVAVQVAEKRADSASPYSSSSSSSSPSTTMSP SLSISPPPTPPPAPLLAPVPVYPSALQMLQHQQQSAQSLFSCLMMNLNCSPIGAIPIEGPHTLTGGGAPPVFSPNSAFTP LVLNEQLGAALATMYLKGLVKIDTRRVP
view sequence (348 aa)
>Cjp-MAB-3, isoform b
MNATVSPAALLLRAHRREKRLFVCLCPQKKEHKKSRKEELMLTEDSTPEMCEALIAEQEKNYYCQRCLNHGELNPRKGHK
PDCGYLKCPCAECTMVEQRRQLNNLLSKKKVHITPATATKNGKRVRDPHCARCSAHGVLVPLRGHKRTMCQFVTCTCTLC
ELVEHRRMLMAAQIKLRRLQQKTRDGKEPVKRSGGRKSKNAVEDMEPATVAVQVAEKRADSASPYSSSSSSSSPSTTMSP
SLSISPPPTPPPAPLLAPVPVYPSALQMLQHQQQSAQSLFSCLMMNLNCSPIGAIPIEGPHTLTGGGAPPVFSPNSAFTP
LVLNEQLGAALATMYLKGLVKIDTRRVP
Estimated Isoelectric Point:
9.52774810791016
Estimated Molecular Weight:
38.3 kD
Amino Acid Composition:
Amino Acid Frequency
Thr21
Lys25
Gln17
Leu36
Gly16
Met13
Ser29
Tyr6
His11
Glu20
Arg24
Cys17
Phe5
Pro32
Val20
Asn12
Ala29
Ile8
Asp7