Sequence:
download
JA49011sequence.fasta
>Cjp-CEH-22 MYTLPPVDPFQRPENDIIENGSGDKSDKDGLKVDDDEEIIDEMDDENDEEDDGTGKRKKRKRRVLFTKAQTYELERRFQT QKYLSAPEREQLAMQIRLTPTQVKIWFQNHRYKTKKSHQDKPMSSTILSSTFPGQAVNAAFQTRTMPIQMLVRGSGDSSA RSSDISSTSPYTVAFGTANSGYLHTPSAYLPAATSGYFNGQTNTPYMTNTGSWWSS
view sequence (216 aa)
>Cjp-CEH-22
MYTLPPVDPFQRPENDIIENGSGDKSDKDGLKVDDDEEIIDEMDDENDEEDDGTGKRKKRKRRVLFTKAQTYELERRFQT
QKYLSAPEREQLAMQIRLTPTQVKIWFQNHRYKTKKSHQDKPMSSTILSSTFPGQAVNAAFQTRTMPIQMLVRGSGDSSA
RSSDISSTSPYTVAFGTANSGYLHTPSAYLPAATSGYFNGQTNTPYMTNTGSWWSS
Estimated Isoelectric Point:
5.96601104736328
Estimated Molecular Weight:
24.4 kD
Amino Acid Composition:
Amino Acid Frequency
Thr21
Lys14
Gln13
Leu11
Gly13
Met7
Ser22
Tyr9
His3
Glu12
Arg13
Phe8
Pro13
Val7
Asn9
Ala12
Ile9
Trp3
Asp17