Sequence:
download
JA48618sequence.fasta
>Cjp-HIM-17.2 MQPGTSSLQTIVIKTDDDDDDVVDVIDYSDDSDEENEMIEKLSEIPYPKRLCQVCSAVEPLENEASFEFKFTIRTWPFDE FRHKKWLEIMDWPQEFEESMKTLWQKRKTEGSLTNAYHYCPINVCQSHLDFRQLPERMEQWHQTFCVLCDSCMSDKSLLV PLPPDFETRQKWIQSLFPFDESSKFHVKKVLWLRRRLIRPKPTRYRICVYHFSRKAFIVNDDGKVLLDEHALPLAMDSDD FDMTPRGPNSVCKCLLCDDWKKVEDMATLRNPSTESEKLFLIDMLCQTEKMVVKKALSTLAKADRAALICSLHFPDNIDP FSIIAERRLMYGVQSECVLCAHVNDCTNMIPFPGPEDEKLRTKWVNAMCREPWIYRYLTTRLEKRGRHYLCSSHFNRNSL RYHSGLGLWRRPSATPVLACTTEEERQEVWDLSKALPAYHPLVLEAFDTDDCEALDYDDVYSFLGAARMLEIENELNIHG RNVALAVRELRESRKKNKNNHGRQFYEVPDMYEQEEIQEIQEVVEVQEVVEVDESAEEETVQEECIIYEEEHQLEQA
view sequence (557 aa)
>Cjp-HIM-17.2
MQPGTSSLQTIVIKTDDDDDDVVDVIDYSDDSDEENEMIEKLSEIPYPKRLCQVCSAVEPLENEASFEFKFTIRTWPFDE
FRHKKWLEIMDWPQEFEESMKTLWQKRKTEGSLTNAYHYCPINVCQSHLDFRQLPERMEQWHQTFCVLCDSCMSDKSLLV
PLPPDFETRQKWIQSLFPFDESSKFHVKKVLWLRRRLIRPKPTRYRICVYHFSRKAFIVNDDGKVLLDEHALPLAMDSDD
FDMTPRGPNSVCKCLLCDDWKKVEDMATLRNPSTESEKLFLIDMLCQTEKMVVKKALSTLAKADRAALICSLHFPDNIDP
FSIIAERRLMYGVQSECVLCAHVNDCTNMIPFPGPEDEKLRTKWVNAMCREPWIYRYLTTRLEKRGRHYLCSSHFNRNSL
RYHSGLGLWRRPSATPVLACTTEEERQEVWDLSKALPAYHPLVLEAFDTDDCEALDYDDVYSFLGAARMLEIENELNIHG
RNVALAVRELRESRKKNKNNHGRQFYEVPDMYEQEEIQEIQEVVEVQEVVEVDESAEEETVQEECIIYEEEHQLEQA
Estimated Isoelectric Point:
4.92118072509766
Estimated Molecular Weight:
65.5 kD
Amino Acid Composition:
Amino Acid Frequency
Thr25
Lys32
Gln22
Leu52
Gly12
Met16
Ser34
Tyr17
His16
Glu60
Arg36
Cys21
Phe23
Pro29
Val36
Asn19
Ala27
Ile25
Trp12
Asp43