Sequence:
download
JA48179sequence.fasta
>Cjp-BUS-17 MMAIYGYVIDQLPSVDQIVVTNDDTIVNATALEQVFSQTAWASNSFTMKDLTSTFSTILSFITTSILAILQSI
view sequence (73 aa)
>Cjp-BUS-17
MMAIYGYVIDQLPSVDQIVVTNDDTIVNATALEQVFSQTAWASNSFTMKDLTSTFSTILSFITTSILAILQSI
Estimated Isoelectric Point:
3.61231231689453
Estimated Molecular Weight:
8.0 kD
Amino Acid Composition:
Amino Acid Frequency
Thr10
Lys1
Gln5
Leu6
Gly1
Met3
Ser9
Tyr2
Glu1
Phe4
Pro1
Val6
Asn3
Ala6
Ile9
Trp1
Asp5