Sequence:
download
JA47232sequence.fasta
>Cjp-ZYG-12, isoform b MIDLTNSDGGTSSDNANSSHHRYGTDSMDSDGPGRSSSRRFVVADEPTIQQNRMDLADLAIWLSGLKATEFPLDNPHDLC NGRAFAELLHEIDKDFFDSDWLDKMPMLTTPTNIVVKRSNLRRLWRKISDYITDQLHRKLPTACRWTEISERVDGFEESD LPVAVDLGMIVVTLAHIGRTQETYVQYSQSLSSKYQREIANVARMISLVMEEFPETLSGLDVSLLDESAHEQKEICMQES TSHAADGKTSRRHTLSNSESLLEAQRESHCKEKDQLLREVDRLTKALDAALLNATPSTETNVDVSLLERQNEKLRFKKRE IEERFHELEAQIEQHRLNLKDLTEENDKLRSGHKDLNLVRSELHSARDAVEEWRAKATKYSEEVEVMKKRKEKEVKDLEL KLDFMNSRIENFVKESTISEDNKKTMDIMRSKIGTLEANIDQMQRQEVSKSHMVNELENKLIEYKERVNELNERKDELVA ERNLLQEQLALNPFSSSQSTILPSPFSEKPQELPQEITIKRLRERIQELETLEPLQGEIIILKSRIGVLEEENLVLSKRK EDLQREVNEYKEKELEKSQKLHVSNDVLELKVQIEKANVELERLREVQARGESRSADLESLVELRTRELEKEKDLLFKAK QIIDELELRSRPVGEDSITSVQQFKELQEENEQLREKVERLAIELHNVSSSLDHENRLFNSAAHQMVLNRSIDDATPTRT RAGADSVPPQTLLETQKMSGALPWSLLVLGFVFSLAWIFIKTLSAVNAPPIA
view sequence (772 aa)
>Cjp-ZYG-12, isoform b
MIDLTNSDGGTSSDNANSSHHRYGTDSMDSDGPGRSSSRRFVVADEPTIQQNRMDLADLAIWLSGLKATEFPLDNPHDLC
NGRAFAELLHEIDKDFFDSDWLDKMPMLTTPTNIVVKRSNLRRLWRKISDYITDQLHRKLPTACRWTEISERVDGFEESD
LPVAVDLGMIVVTLAHIGRTQETYVQYSQSLSSKYQREIANVARMISLVMEEFPETLSGLDVSLLDESAHEQKEICMQES
TSHAADGKTSRRHTLSNSESLLEAQRESHCKEKDQLLREVDRLTKALDAALLNATPSTETNVDVSLLERQNEKLRFKKRE
IEERFHELEAQIEQHRLNLKDLTEENDKLRSGHKDLNLVRSELHSARDAVEEWRAKATKYSEEVEVMKKRKEKEVKDLEL
KLDFMNSRIENFVKESTISEDNKKTMDIMRSKIGTLEANIDQMQRQEVSKSHMVNELENKLIEYKERVNELNERKDELVA
ERNLLQEQLALNPFSSSQSTILPSPFSEKPQELPQEITIKRLRERIQELETLEPLQGEIIILKSRIGVLEEENLVLSKRK
EDLQREVNEYKEKELEKSQKLHVSNDVLELKVQIEKANVELERLREVQARGESRSADLESLVELRTRELEKEKDLLFKAK
QIIDELELRSRPVGEDSITSVQQFKELQEENEQLREKVERLAIELHNVSSSLDHENRLFNSAAHQMVLNRSIDDATPTRT
RAGADSVPPQTLLETQKMSGALPWSLLVLGFVFSLAWIFIKTLSAVNAPPIA
Estimated Isoelectric Point:
5.19921112060547
Estimated Molecular Weight:
88.9 kD
Amino Acid Composition:
Amino Acid Frequency
Thr38
Lys53
Gln36
Leu96
Gly21
Met17
Ser69
Tyr8
His19
Glu96
Arg57
Cys4
Phe19
Pro23
Val44
Asn36
Ala43
Ile38
Trp7
Asp48