Sequence:
download
JA45348sequence.fasta
>Cjp-LIN-42 MEPAGHSSATPNIVVPTAAQPPAVMREEGATLSPPNTWSSSSVEFLDDDSDNRLLFTCTFTLPHGTVLSSSTYSDAFTDH YLPIGANFLTRLEPKGQSFILSAAAASVKQRIFARVTMPDGHLRACELLCEFETDRAKITVLALRSAFSPSIGGFHVFTF ITKHSSTCALTHIDYASIPYLGLLPTDLIGKSLLAFVYAPDVHVVRQAHIDLNNSKGKIVKSIADLRLVAHNGSILRCQT EWSAYVNPWTRKMELVVARHRICSPPIGDYDVLSPPPPGLQNTLPPVMAKTFEDELRTIMNKVRFCFGLLDYKLLVFGLL L
view sequence (321 aa)
>Cjp-LIN-42
MEPAGHSSATPNIVVPTAAQPPAVMREEGATLSPPNTWSSSSVEFLDDDSDNRLLFTCTFTLPHGTVLSSSTYSDAFTDH
YLPIGANFLTRLEPKGQSFILSAAAASVKQRIFARVTMPDGHLRACELLCEFETDRAKITVLALRSAFSPSIGGFHVFTF
ITKHSSTCALTHIDYASIPYLGLLPTDLIGKSLLAFVYAPDVHVVRQAHIDLNNSKGKIVKSIADLRLVAHNGSILRCQT
EWSAYVNPWTRKMELVVARHRICSPPIGDYDVLSPPPPGLQNTLPPVMAKTFEDELRTIMNKVRFCFGLLDYKLLVFGLL
L
Estimated Isoelectric Point:
6.82338714599609
Estimated Molecular Weight:
35.3 kD
Amino Acid Composition:
Amino Acid Frequency
Thr24
Lys12
Gln6
Leu38
Gly16
Met6
Ser28
Tyr8
His11
Glu12
Arg16
Cys7
Phe17
Pro24
Val22
Asn10
Ala27
Ile17
Trp3
Asp17