Sequence:
download
JA45093sequence.fasta
>CJA09385, isoform a MLTFIGDALAGPLRARRGSASGQLTMLSTTSPFITSDPGKQNAYCDASANLLTNIFLVDVSDPIIGTIDDKLSKISNFLL NVPSQVNLSSNDDWNGQEFRLVVYGGNEPFPLGRARNQQSWNKVVSELNTTIVNPTKLDGHQMTDALRFVFNNYRPAYGT AGNIIVVGDGFDFDEMESATTISTALKYQYRFSLGFLLMTTSQVQRSVVQPLASDFSHFYPIDSVDYLSNPAVVQTQANW ICSAFYPVPAPPTPPPTRLPLLTTATTAGPLTQTTANPLLPPISSCTQNVLFLIDQSQTLLVNGYNNIIQFDVLDGLPES IYVGVSQPDAILDDQIINSTSYKLRCKGSSNCFTGITFVMETSQAEGYNYVDVQKLSIINVLNHYTAPVSVSLVYFSSPD SLDPNNPDRSGILFGQITNSTNAINILNTTNFDLGAASDLELGFTKTLESLNKGYLENNNLVIFFARGAYERLSNCCPDP TAAANAVKQQATVQGVMIGPYSSKSQLDSLTGSNSIDANALIGGNTLNSTQDRLDAADQISDAIIPIIDSFLNNEVCSGI PGYADPPCEDPIDVLVLLHANSLENWNRIKNFTANELLPSLLGETGAVANKQLTTSTPVNFAVASYYYLDVVDHADFTYL LSVEDYQNLLTKISYRETKGTATLSTAYKKAIEIFEDGRPYASKNLILITDTLDISDLEDAFSEHDAMTQLVGGYTTALA INTDIIPGADYQINIDPSQLDSYNRYTRRKLANSLTQNNCVYKPVQVPTLPPVTPSPTLPGPIPLVKARNVWPDITILID TSKSQENPMNDELFEKIRAFLDILLIQYSVGKHGSRFTVATYDGDTVEYSCIFDQDSYYDLSSCRNERLSLFSRNHENYR NVDGVLSDVLHNVYQNNTSGYRSLNENFLVLFTLGASSTPFTQQLKNIERKGIRTIAIGLSNNISNNDLSQFSRTAFSVP DWSSSFSGIDTNYDLADRIFQITTKKRLPSSSNFFGNLVFIVDQSGNSASDHSNIVQYVTDFVTPYLIDPVKTQISIVPF AGSVISPLSINSSQTEVDSWLDSWKLTTASSDYSANVGSAIQFAASELGSTYDRPTHVVFVLGSANVTGTELAQQLLNGS NLYVASYNIANNTDFNNLVFTSDRIYSVNSSVELLNRVVSLDVTKPNPMLVLDKDILETQEKNDQSSFPTSSIAADVIML LDETGLEDNEFETMKQFLSNFTQKFSVGSESTQFALQSYNGRTIPHDGFHLYESTSGEVVKNRIQQLTLAKAAENSTDAD LAGAIEQEIFFFLTEKNGWREDTTTYTIIFSHADSFYTRDTDTAMGVKNVSSVFSLGVNGMKFDYVQNFTNTGFYETVAG VSALNINAPEVADLLAAINNDYKNLVYPSTHSVKEIVKADFIFLIDSSLGSSKNQAVQQFLLDFTANVGTFSSSGNDTRM AVVVYGKSATTLWNLQNAQDIDSLRNRISQIQITSSSSGTVNLRRAIDSIILNEGDFGVDYNRPEYIIDIASSLTISPTI DTATSRHLNTRYSTFVMQTNNDNSTFSYCSQVLGTKLFTDRVAINPELSFDNSEAQGKLFSWISNEFSAWSTTFPDKS
view sequence (1598 aa)
>CJA09385, isoform a
MLTFIGDALAGPLRARRGSASGQLTMLSTTSPFITSDPGKQNAYCDASANLLTNIFLVDVSDPIIGTIDDKLSKISNFLL
NVPSQVNLSSNDDWNGQEFRLVVYGGNEPFPLGRARNQQSWNKVVSELNTTIVNPTKLDGHQMTDALRFVFNNYRPAYGT
AGNIIVVGDGFDFDEMESATTISTALKYQYRFSLGFLLMTTSQVQRSVVQPLASDFSHFYPIDSVDYLSNPAVVQTQANW
ICSAFYPVPAPPTPPPTRLPLLTTATTAGPLTQTTANPLLPPISSCTQNVLFLIDQSQTLLVNGYNNIIQFDVLDGLPES
IYVGVSQPDAILDDQIINSTSYKLRCKGSSNCFTGITFVMETSQAEGYNYVDVQKLSIINVLNHYTAPVSVSLVYFSSPD
SLDPNNPDRSGILFGQITNSTNAINILNTTNFDLGAASDLELGFTKTLESLNKGYLENNNLVIFFARGAYERLSNCCPDP
TAAANAVKQQATVQGVMIGPYSSKSQLDSLTGSNSIDANALIGGNTLNSTQDRLDAADQISDAIIPIIDSFLNNEVCSGI
PGYADPPCEDPIDVLVLLHANSLENWNRIKNFTANELLPSLLGETGAVANKQLTTSTPVNFAVASYYYLDVVDHADFTYL
LSVEDYQNLLTKISYRETKGTATLSTAYKKAIEIFEDGRPYASKNLILITDTLDISDLEDAFSEHDAMTQLVGGYTTALA
INTDIIPGADYQINIDPSQLDSYNRYTRRKLANSLTQNNCVYKPVQVPTLPPVTPSPTLPGPIPLVKARNVWPDITILID
TSKSQENPMNDELFEKIRAFLDILLIQYSVGKHGSRFTVATYDGDTVEYSCIFDQDSYYDLSSCRNERLSLFSRNHENYR
NVDGVLSDVLHNVYQNNTSGYRSLNENFLVLFTLGASSTPFTQQLKNIERKGIRTIAIGLSNNISNNDLSQFSRTAFSVP
DWSSSFSGIDTNYDLADRIFQITTKKRLPSSSNFFGNLVFIVDQSGNSASDHSNIVQYVTDFVTPYLIDPVKTQISIVPF
AGSVISPLSINSSQTEVDSWLDSWKLTTASSDYSANVGSAIQFAASELGSTYDRPTHVVFVLGSANVTGTELAQQLLNGS
NLYVASYNIANNTDFNNLVFTSDRIYSVNSSVELLNRVVSLDVTKPNPMLVLDKDILETQEKNDQSSFPTSSIAADVIML
LDETGLEDNEFETMKQFLSNFTQKFSVGSESTQFALQSYNGRTIPHDGFHLYESTSGEVVKNRIQQLTLAKAAENSTDAD
LAGAIEQEIFFFLTEKNGWREDTTTYTIIFSHADSFYTRDTDTAMGVKNVSSVFSLGVNGMKFDYVQNFTNTGFYETVAG
VSALNINAPEVADLLAAINNDYKNLVYPSTHSVKEIVKADFIFLIDSSLGSSKNQAVQQFLLDFTANVGTFSSSGNDTRM
AVVVYGKSATTLWNLQNAQDIDSLRNRISQIQITSSSSGTVNLRRAIDSIILNEGDFGVDYNRPEYIIDIASSLTISPTI
DTATSRHLNTRYSTFVMQTNNDNSTFSYCSQVLGTKLFTDRVAINPELSFDNSEAQGKLFSWISNEFSAWSTTFPDKS
Estimated Isoelectric Point:
4.54573822021484
Estimated Molecular Weight:
175.6 kD
Amino Acid Composition:
Amino Acid Frequency
Thr135
Lys50
Gln71
Leu151
Gly82
Met16
Ser172
Tyr62
His16
Glu57
Arg51
Cys13
Phe81
Pro72
Val107
Asn129
Ala104
Ile105
Trp12
Asp112