Sequence:
download
JA41533sequence.fasta
>Cjp-DCS-1 MTSTTEETAQNWLAKAKYEEVLGADSSHKTLFLLLSHPNGEQGILLANKTPFSEQQSVIEELLKSAKLKELSKNDIFGSY EIEIDKHLNVLKSQLIFPVNDRLIAKYRQEDKLVIRETPKLYQTVTKPYIEKFQLNLKWVYNCLEKVSEADKIVFEDDDK KDGFVLMQDIKWDGKTLENLYLLAIVHRHGLKSVRDLTGDDLPMLYSIRDKSLDAIHDKYGLAKDQVKCYFHYQPSFYHL HVHFINLKYDAPASTTMSAILLDDVINNLELNSQHYELSTLTFTRKKSDMLTELFQAANEL
view sequence (301 aa)
>Cjp-DCS-1
MTSTTEETAQNWLAKAKYEEVLGADSSHKTLFLLLSHPNGEQGILLANKTPFSEQQSVIEELLKSAKLKELSKNDIFGSY
EIEIDKHLNVLKSQLIFPVNDRLIAKYRQEDKLVIRETPKLYQTVTKPYIEKFQLNLKWVYNCLEKVSEADKIVFEDDDK
KDGFVLMQDIKWDGKTLENLYLLAIVHRHGLKSVRDLTGDDLPMLYSIRDKSLDAIHDKYGLAKDQVKCYFHYQPSFYHL
HVHFINLKYDAPASTTMSAILLDDVINNLELNSQHYELSTLTFTRKKSDMLTELFQAANEL
Estimated Isoelectric Point:
5.79009246826172
Estimated Molecular Weight:
34.8 kD
Amino Acid Composition:
Amino Acid Frequency
Thr17
Lys30
Gln13
Leu43
Gly9
Met5
Ser20
Tyr14
His11
Glu22
Arg7
Cys2
Phe12
Pro8
Val15
Asn14
Ala16
Ile17
Trp3
Asp23