Sequence:
download
JA41489sequence.fasta
>Cjp-GLD-2 MPTTSSSSTLSCDVDSFVTKVDTDGTLFVKSQESPSENAHSTNNGFHVMNYPARRNWNNSISTQSSSSTTPNSLGRTSTC TSSTSSTSSETKLSREDVNVQTSSSMILSSEEEEDEDDDDDDDDEEEHVEDSEDEICDDVESCEESDEDDDTVSEEQDSE DDEYTAQEPEPMFVSSWSFAMGTQRSLPGEPHSNVEQMVEWELEIVERAHRESKLAELYADLSWRFYTHAPTSFCLARIH MRNGLTGWEGMSVWNLPARKSPTRRDSESTSVSLLSTPSDSPANGVDESTLTKILPTDEFRGGRGVASPGPPASLVSEPL SRMDVLSEKIWDYHNKVAQTDEMLQRKLHLRDMLYTAISPVFPMSGLYVVGSSLNGFGNNSSDMDLCLMITNKDLDQKND AVVVLNLILSTLQYEKFVASQKLILAKVPILRIKFAAPFDDITVDLNANNSVAIRNTHLLCYYSSYDWRVRPLVSVVKEW AKRKGINDANKSSFTSYSLVLMVIHYLQCGTTPKVLPNLQQTYPDRFSNKVDVRTLNVTMPLDQKHDNLEQTSPSEKTTL GELLIGFLDYYANRFDYDHDAISIRQGQRVERAALAARPKMHTSGDKETPPPSSSASSSSLHNNGNNVNAGALTSVMMHH AMSNPHFWRSQWRCVCIEEPFTNSNTAHSIYDEMVFGAIKEAFREAHGELQHNHDLDRLMECEPIKASITNAGAAVFAAT YEGERPQAQQPNSIATASLRAMNVMGPGTPVSGGPPVGHFHFQQQQSQVLKQQRSNNQQQNYHMNSHRNNSSNNAGHRRS YQQNGGSARIARSSESFNKETSLSRHQQMQRGGGGGGAKENVPEKKQHQQRREER
view sequence (855 aa)
>Cjp-GLD-2
MPTTSSSSTLSCDVDSFVTKVDTDGTLFVKSQESPSENAHSTNNGFHVMNYPARRNWNNSISTQSSSSTTPNSLGRTSTC
TSSTSSTSSETKLSREDVNVQTSSSMILSSEEEEDEDDDDDDDDEEEHVEDSEDEICDDVESCEESDEDDDTVSEEQDSE
DDEYTAQEPEPMFVSSWSFAMGTQRSLPGEPHSNVEQMVEWELEIVERAHRESKLAELYADLSWRFYTHAPTSFCLARIH
MRNGLTGWEGMSVWNLPARKSPTRRDSESTSVSLLSTPSDSPANGVDESTLTKILPTDEFRGGRGVASPGPPASLVSEPL
SRMDVLSEKIWDYHNKVAQTDEMLQRKLHLRDMLYTAISPVFPMSGLYVVGSSLNGFGNNSSDMDLCLMITNKDLDQKND
AVVVLNLILSTLQYEKFVASQKLILAKVPILRIKFAAPFDDITVDLNANNSVAIRNTHLLCYYSSYDWRVRPLVSVVKEW
AKRKGINDANKSSFTSYSLVLMVIHYLQCGTTPKVLPNLQQTYPDRFSNKVDVRTLNVTMPLDQKHDNLEQTSPSEKTTL
GELLIGFLDYYANRFDYDHDAISIRQGQRVERAALAARPKMHTSGDKETPPPSSSASSSSLHNNGNNVNAGALTSVMMHH
AMSNPHFWRSQWRCVCIEEPFTNSNTAHSIYDEMVFGAIKEAFREAHGELQHNHDLDRLMECEPIKASITNAGAAVFAAT
YEGERPQAQQPNSIATASLRAMNVMGPGTPVSGGPPVGHFHFQQQQSQVLKQQRSNNQQQNYHMNSHRNNSSNNAGHRRS
YQQNGGSARIARSSESFNKETSLSRHQQMQRGGGGGGAKENVPEKKQHQQRREER
Estimated Isoelectric Point:
5.14644622802734
Estimated Molecular Weight:
95.4 kD
Amino Acid Composition:
Amino Acid Frequency
Thr54
Lys32
Gln42
Leu61
Gly43
Met26
Ser107
Tyr21
His29
Glu63
Arg47
Cys11
Phe25
Pro42
Val52
Asn54
Ala52
Ile27
Trp11
Asp56