Sequence:
download
JA40034sequence.fasta
>Cjp-BUS-2 MNFPGLRFYPDSKCLVKADVDNVLILRNYERLCEEAVAPLILGKCDVPKTVLRNTTKWAVPEYVYSNPIWPTYCSTGTYV MAGKTVPQRLIKEAMQSQFANSLNFRKLSEDVIFTGILAERAGIRRRHINGLSFFEIPEYFCRNGYKTTYSTHLLSDKNP VKNYKKVMKLEGVLCRWWDPYAVRKWWL
view sequence (188 aa)
>Cjp-BUS-2
MNFPGLRFYPDSKCLVKADVDNVLILRNYERLCEEAVAPLILGKCDVPKTVLRNTTKWAVPEYVYSNPIWPTYCSTGTYV
MAGKTVPQRLIKEAMQSQFANSLNFRKLSEDVIFTGILAERAGIRRRHINGLSFFEIPEYFCRNGYKTTYSTHLLSDKNP
VKNYKKVMKLEGVLCRWWDPYAVRKWWL
Estimated Isoelectric Point:
9.43631744384766
Estimated Molecular Weight:
21.9 kD
Amino Acid Composition:
Amino Acid Frequency
Thr11
Lys15
Gln3
Leu18
Gly9
Met4
Ser9
Tyr11
His2
Glu10
Arg13
Cys6
Phe8
Pro11
Val15
Asn11
Ala10
Ile9
Trp6
Asp7