Sequence:
download
JA39788sequence.fasta
>Cjp-LEV-10 MKMHFLQLLLVPFITNTVTSLDSRKTIFQCDQHFDESQPEGIINFPSLPKQLAISHGINSSKPELRYNLQCVYTFVAGPR QRVILEFDHFLLSGSSENCDIEYIDIYSEIENVDEDILSSTLGGRYCGTVAPHVRISLRNVMKLVLHSRSTNHEENHGFS AKYSFIPGEKFISGASVSGQKCGYIIDSSVLKAGTVYSPTYPGTYPHNMHCSYLLKGYPEERIRLFFSDFDIFFGGEHCP YDSITIFDGDSPSAPIIRKVCGLQQRMEIYSMTNTLLIHFNTTQPAKSDPRGFIMDYEFSSRFVKIHKLLNGQKGVTHIR GTECDVRVESNRETTHTISSPNYPEVYPANTTCTYIIHGLQGEQNLENVILTFQSIAVLSFDTALATATPSADDIACPSA WVGIATSEGNMRAVMSSTDDSIFDVTLCERIPSGSPLLGPYVSEGPRMVMQFGSTDTRDDQISPIGFKATIEFRTDFGVT GDSLGTSNECRFRFNSSTGFFNSPRYPANYPLDTNCTYYIVAEPEKEILLHFEQFALSGDNRNCDDYLEVYDVFVENGEE KLRLKERYCSDTFPGPSVSAFGSHEMRIFFTSGSTGTANGFKALFEIRTARKEDVPSGEAHIRRGSYRCGSVINATTEKP NGLIISPNYPVKYNKDVHCDWKINAREGYQVLLKMEAIDVEGEMTTTSASCQKAVIRVEGAPKPEYCGTKREFFESFLSD SNTVRISFLTAPDKVNGLKGFNLSWTEVKNLSGKDESVCKSDTLYLCTYSKLCIDSKLRCNGLDNCGYLVQDDTDEQHSR VIIFFKNDFGFLLMGFPSSDWKISPHEELLNLVNGIKVCAFVSCCFLCALHIGSLKEKTGDRTVVLAAIFCGGIFVFICG FFLYLFKKKLERKKKSKRKSDTKHRLRQPYRQQKPMNRPHCDSQLSSPATSRFVHHDATGIMPPIQLHHIRNTPEEFYTN
view sequence (960 aa)
>Cjp-LEV-10
MKMHFLQLLLVPFITNTVTSLDSRKTIFQCDQHFDESQPEGIINFPSLPKQLAISHGINSSKPELRYNLQCVYTFVAGPR
QRVILEFDHFLLSGSSENCDIEYIDIYSEIENVDEDILSSTLGGRYCGTVAPHVRISLRNVMKLVLHSRSTNHEENHGFS
AKYSFIPGEKFISGASVSGQKCGYIIDSSVLKAGTVYSPTYPGTYPHNMHCSYLLKGYPEERIRLFFSDFDIFFGGEHCP
YDSITIFDGDSPSAPIIRKVCGLQQRMEIYSMTNTLLIHFNTTQPAKSDPRGFIMDYEFSSRFVKIHKLLNGQKGVTHIR
GTECDVRVESNRETTHTISSPNYPEVYPANTTCTYIIHGLQGEQNLENVILTFQSIAVLSFDTALATATPSADDIACPSA
WVGIATSEGNMRAVMSSTDDSIFDVTLCERIPSGSPLLGPYVSEGPRMVMQFGSTDTRDDQISPIGFKATIEFRTDFGVT
GDSLGTSNECRFRFNSSTGFFNSPRYPANYPLDTNCTYYIVAEPEKEILLHFEQFALSGDNRNCDDYLEVYDVFVENGEE
KLRLKERYCSDTFPGPSVSAFGSHEMRIFFTSGSTGTANGFKALFEIRTARKEDVPSGEAHIRRGSYRCGSVINATTEKP
NGLIISPNYPVKYNKDVHCDWKINAREGYQVLLKMEAIDVEGEMTTTSASCQKAVIRVEGAPKPEYCGTKREFFESFLSD
SNTVRISFLTAPDKVNGLKGFNLSWTEVKNLSGKDESVCKSDTLYLCTYSKLCIDSKLRCNGLDNCGYLVQDDTDEQHSR
VIIFFKNDFGFLLMGFPSSDWKISPHEELLNLVNGIKVCAFVSCCFLCALHIGSLKEKTGDRTVVLAAIFCGGIFVFICG
FFLYLFKKKLERKKKSKRKSDTKHRLRQPYRQQKPMNRPHCDSQLSSPATSRFVHHDATGIMPPIQLHHIRNTPEEFYTN
Estimated Isoelectric Point:
6.20558929443359
Estimated Molecular Weight:
107.9 kD
Amino Acid Composition:
Amino Acid Frequency
Thr64
Lys51
Gln27
Leu72
Gly65
Met17
Ser89
Tyr37
His29
Glu59
Arg49
Cys32
Phe61
Pro49
Val53
Asn45
Ala40
Ile64
Trp4
Asp53