Sequence:
download
JA18341sequence.fasta
>Cjp-RHEB-1 MSTSFNSNRRSGSTNTNRLNRKVAVMGYPHVGKSALVLRFTQNVFPEKYESTIEDQHQKQLSFFQRDYNLRVTDTGGQQE YTVFPRSCSLDINGFILVYAIDDRKSFEMCSNIYDKIVRTYGDTSIPIVVVGNKTDLGAQRVVQFDEGEALARQWDAKFL EITARELNRVNEVFELLLREIEISRGNISANDHRRGGGASSPSAFRSSVHANNRSSSPDGKSCIIS
view sequence (226 aa)
>Cjp-RHEB-1
MSTSFNSNRRSGSTNTNRLNRKVAVMGYPHVGKSALVLRFTQNVFPEKYESTIEDQHQKQLSFFQRDYNLRVTDTGGQQE
YTVFPRSCSLDINGFILVYAIDDRKSFEMCSNIYDKIVRTYGDTSIPIVVVGNKTDLGAQRVVQFDEGEALARQWDAKFL
EITARELNRVNEVFELLLREIEISRGNISANDHRRGGGASSPSAFRSSVHANNRSSSPDGKSCIIS
Estimated Isoelectric Point:
8.77291107177734
Estimated Molecular Weight:
25.4 kD
Amino Acid Composition:
Amino Acid Frequency
Thr12
Lys9
Gln10
Leu14
Gly15
Met3
Ser25
Tyr7
His4
Glu13
Arg20
Cys3
Phe12
Pro6
Val17
Asn16
Ala12
Ile14
Trp1
Asp13