Sequence:
download
JA16393sequence.fasta
>Cjp-RME-2 MRFAWLLTTSILHLLIQTTTQAPVSPDNSTCDTTKQFDCRAGHPRCIPAEWQCDNLPDCQNGADESGCSYAHHCPSQFML CKTGLCISAEFKCDNEVDCEDGSDELYCELHNPPHPDSFVSLSTHTNRPECHPPRMRCSSGQCIQPDLVCDGHDDCVGGD DEVNCTRRAEQSVEVDNLADPTVLTNMDDLEETQECRPNYMQCHSGDVCIPNAFICDGQSDCDDGSDELNCESNTLSEEQ FLTGEAAHIHACTAANMFPCQQKNGEVSLCLPMNATCNGLKECPLGDDESRQCSECARKRCDHTCMNTPNGARCICQEGY ELAADGLTCEDEDECATHGHVCQHFCEDRLGSFVCKCANGYQLGQDGHSCSYESTTSSVGYLFISLGGEIRQMPLADYHD GDKYSQVQKHTGHGRIRSIDFMHRNNKMFVTIDDDRHSEGVLAVSDNGLMRTLRENVIGIGSVAVDWIGGNVFFTQQSPA PETGISVCSMSGMFCRRIVEGKPMGQSYRGLVVHPMRGLLIWIESQQTSHRIMIANMDGSNVRVLVDNKLEMPSALAIDY VRHDIYFGDVEKQLIERVNIDSKVRNVVISSGVHHPFDMAYFNGLLYWSDWGSETLKVQEMTHHHSTPHVIHTFNRFPYG IAVNHSLYQTGPPSNPCMNFDCPWLCIIVPKSESIMTGKCVCPDGYTSIADSCIPPSIKETEEKLVNRSHIGAALMAEYC EAGVACFDRGSCRDLVNEHGRIHRVVCDCEEPYDGEFCEYLNPEKLAAMEAEDGIAGLIGLLFIVLLILVVVCVILYFWF ARRDMANDVIATARVRVDNMTRKAEDVAAPIVEKLKRVADRHSHSRSPQGCHSATNVNFVTDETAQERRARMHISPSSYD NPLYDAVPGGASGAEGGIPAISTAAPFAGVIRFEDDSLL
view sequence (919 aa)
>Cjp-RME-2
MRFAWLLTTSILHLLIQTTTQAPVSPDNSTCDTTKQFDCRAGHPRCIPAEWQCDNLPDCQNGADESGCSYAHHCPSQFML
CKTGLCISAEFKCDNEVDCEDGSDELYCELHNPPHPDSFVSLSTHTNRPECHPPRMRCSSGQCIQPDLVCDGHDDCVGGD
DEVNCTRRAEQSVEVDNLADPTVLTNMDDLEETQECRPNYMQCHSGDVCIPNAFICDGQSDCDDGSDELNCESNTLSEEQ
FLTGEAAHIHACTAANMFPCQQKNGEVSLCLPMNATCNGLKECPLGDDESRQCSECARKRCDHTCMNTPNGARCICQEGY
ELAADGLTCEDEDECATHGHVCQHFCEDRLGSFVCKCANGYQLGQDGHSCSYESTTSSVGYLFISLGGEIRQMPLADYHD
GDKYSQVQKHTGHGRIRSIDFMHRNNKMFVTIDDDRHSEGVLAVSDNGLMRTLRENVIGIGSVAVDWIGGNVFFTQQSPA
PETGISVCSMSGMFCRRIVEGKPMGQSYRGLVVHPMRGLLIWIESQQTSHRIMIANMDGSNVRVLVDNKLEMPSALAIDY
VRHDIYFGDVEKQLIERVNIDSKVRNVVISSGVHHPFDMAYFNGLLYWSDWGSETLKVQEMTHHHSTPHVIHTFNRFPYG
IAVNHSLYQTGPPSNPCMNFDCPWLCIIVPKSESIMTGKCVCPDGYTSIADSCIPPSIKETEEKLVNRSHIGAALMAEYC
EAGVACFDRGSCRDLVNEHGRIHRVVCDCEEPYDGEFCEYLNPEKLAAMEAEDGIAGLIGLLFIVLLILVVVCVILYFWF
ARRDMANDVIATARVRVDNMTRKAEDVAAPIVEKLKRVADRHSHSRSPQGCHSATNVNFVTDETAQERRARMHISPSSYD
NPLYDAVPGGASGAEGGIPAISTAAPFAGVIRFEDDSLL
Estimated Isoelectric Point:
4.93164825439453
Estimated Molecular Weight:
101.6 kD
Amino Acid Composition:
Amino Acid Frequency
Thr45
Lys23
Gln33
Leu60
Gly66
Met28
Ser68
Tyr23
His40
Glu61
Arg48
Cys58
Phe30
Pro46
Val61
Asn43
Ala59
Ile49
Trp8
Asp70