Sequence:
download
JA14936sequence.fasta
>Cjp-UAF-1 MSESGTLEDIERQFLDAAQREGLESIQVKTENGDIPEAENGHGDRENRDDEDRKKRKRSRSRDRGDRDRDRDRKRSRSRD RRDKDRDRSRSRDRRRDRSRERPSRDDRREDRRDDRRREEPSKPREPKKYRFWDVPPTGFEHTTPMEYKNMQAAGQVPRG SMQSAVPVVGPSVTCQSRRLYVGNIPFGCNEEAMLDFFNQQMHLCGLAQAPGNPILLCQINLDKNFAFIEFRSIDETTAG MAFDGINFMGQQLKVRRPRDYQPSQNTFDMNSRMPVSSIVVDSPNKIFIGGLPNYLTEEQVKELLCSFGPLKAFSLNVDS QGQSKGYAFAEYLDPTLTDQAIAGLNGMQLGDKQLVVQLACTNQTRHNTQLPNSASAIAGIDLSQGAGRATEILCLMNMV TEDELRSDEDYEEILEDVREECSKYGIVRSLEIPRPYEGHLVPGVGKVFVEFATTSDCQRAQAALTGRKFANRTVVTSYY DVDKYHNRQF
view sequence (490 aa)
>Cjp-UAF-1
MSESGTLEDIERQFLDAAQREGLESIQVKTENGDIPEAENGHGDRENRDDEDRKKRKRSRSRDRGDRDRDRDRKRSRSRD
RRDKDRDRSRSRDRRRDRSRERPSRDDRREDRRDDRRREEPSKPREPKKYRFWDVPPTGFEHTTPMEYKNMQAAGQVPRG
SMQSAVPVVGPSVTCQSRRLYVGNIPFGCNEEAMLDFFNQQMHLCGLAQAPGNPILLCQINLDKNFAFIEFRSIDETTAG
MAFDGINFMGQQLKVRRPRDYQPSQNTFDMNSRMPVSSIVVDSPNKIFIGGLPNYLTEEQVKELLCSFGPLKAFSLNVDS
QGQSKGYAFAEYLDPTLTDQAIAGLNGMQLGDKQLVVQLACTNQTRHNTQLPNSASAIAGIDLSQGAGRATEILCLMNMV
TEDELRSDEDYEEILEDVREECSKYGIVRSLEIPRPYEGHLVPGVGKVFVEFATTSDCQRAQAALTGRKFANRTVVTSYY
DVDKYHNRQF
Estimated Isoelectric Point:
6.40522003173828
Estimated Molecular Weight:
56.1 kD
Amino Acid Composition:
Amino Acid Frequency
Thr22
Lys21
Gln28
Leu32
Gly33
Met13
Ser34
Tyr13
His6
Glu37
Arg57
Cys9
Phe20
Pro25
Val26
Asn23
Ala28
Ile19
Trp1
Asp43