Sequence:
download
JA14655sequence.fasta
>Cjp-EGL-30 MACCLSEEAREQKRINQEIEKQLQRDKRNARRELKLLLLGTGESGKSTFIKQMRIIHGQGYSDEDKRAHIRLVYQNVFMA IQSMIRAMDTLCINFGDQSEELQEKAAVVRAVDFESVTSFEEPYVSYIKELWEDSGIQECYDRRREYQLTDSAKYYLSDL RRLAVPDYLPTEQDILRVRVPTTGIIEYPFDLEQIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVECDN ENRMEESKALFRTIITYPWFTNSSVILFLNKKDLLEEKILYSHLADYFPEYDGPPRDPIAAREFILKMFVDLNPDADKII YSHFTCATDTENIRFVFAAVKDTILQHNLKEYNLV
view sequence (355 aa)
>Cjp-EGL-30
MACCLSEEAREQKRINQEIEKQLQRDKRNARRELKLLLLGTGESGKSTFIKQMRIIHGQGYSDEDKRAHIRLVYQNVFMA
IQSMIRAMDTLCINFGDQSEELQEKAAVVRAVDFESVTSFEEPYVSYIKELWEDSGIQECYDRRREYQLTDSAKYYLSDL
RRLAVPDYLPTEQDILRVRVPTTGIIEYPFDLEQIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVECDN
ENRMEESKALFRTIITYPWFTNSSVILFLNKKDLLEEKILYSHLADYFPEYDGPPRDPIAAREFILKMFVDLNPDADKII
YSHFTCATDTENIRFVFAAVKDTILQHNLKEYNLV
Estimated Isoelectric Point:
5.13384246826172
Estimated Molecular Weight:
41.7 kD
Amino Acid Composition:
Amino Acid Frequency
Thr16
Lys19
Gln17
Leu33
Gly11
Met9
Ser20
Tyr17
His6
Glu34
Arg27
Cys7
Phe18
Pro11
Val21
Asn13
Ala20
Ile28
Trp3
Asp25