Sequence:
download
JA13227sequence.fasta
>Cjp-TRXR-2 MFLHAQEVNTARRLLSTATAQHFDLIVIGGGSGGLSCSKRAADLGAKVALIDGVEPTPHGTTWGIGGTCVNVGCIPKKLM HQAALVGKELKTAEAYGWNGINQSAITHDWNVLVQNVNDRIKGNNWVYKVQLNQKKVKYFKAFAEFVDKTTIVVTSADKK KTETVLTASKIVISTGLRPRYPECVGRELGITSDDLFSLPKAPGKTLIVGAGYVALECAGLLAGIKQEVEVLIRSRPLKE FDQDCVKLVMEHLKSTGVKVREGSEVAKVEAVGEKKRVTFTGSGHVEEYDTVIWATGRSPKMASLKLSAANVKLEEQSGK ILADEHDRTSTEGIYAIGDVVKGRQELTPLAIQSGKLLADRLFDNSKQTVRFDGIATTVFTPLELSTVGLTEEEAVKKFG SDAIEVYHSHFTPFEFVVPQNKDGEFCYVKAVCLREAPQKVLGLHFVGPNAAEVMQGFAVAFRVGITYSDLELTVAIHPC SAEEFIKLNITKRSGKDPKPQGCCG
view sequence (505 aa)
>Cjp-TRXR-2
MFLHAQEVNTARRLLSTATAQHFDLIVIGGGSGGLSCSKRAADLGAKVALIDGVEPTPHGTTWGIGGTCVNVGCIPKKLM
HQAALVGKELKTAEAYGWNGINQSAITHDWNVLVQNVNDRIKGNNWVYKVQLNQKKVKYFKAFAEFVDKTTIVVTSADKK
KTETVLTASKIVISTGLRPRYPECVGRELGITSDDLFSLPKAPGKTLIVGAGYVALECAGLLAGIKQEVEVLIRSRPLKE
FDQDCVKLVMEHLKSTGVKVREGSEVAKVEAVGEKKRVTFTGSGHVEEYDTVIWATGRSPKMASLKLSAANVKLEEQSGK
ILADEHDRTSTEGIYAIGDVVKGRQELTPLAIQSGKLLADRLFDNSKQTVRFDGIATTVFTPLELSTVGLTEEEAVKKFG
SDAIEVYHSHFTPFEFVVPQNKDGEFCYVKAVCLREAPQKVLGLHFVGPNAAEVMQGFAVAFRVGITYSDLELTVAIHPC
SAEEFIKLNITKRSGKDPKPQGCCG
Estimated Isoelectric Point:
8.33818817138672
Estimated Molecular Weight:
54.8 kD
Amino Acid Composition:
Amino Acid Frequency
Thr36
Lys43
Gln17
Leu43
Gly46
Met5
Ser27
Tyr10
His12
Glu36
Arg19
Cys11
Phe20
Pro18
Val51
Asn15
Ala43
Ile26
Trp5
Asp22