Sequence:
download
JA11568sequence.fasta
>Cjp-BUS-19 MTRLFILPAIFGISSLSLWWMICSAPGWPESEGGVFEIPKQFDNFTVLAEKFRSYKEDHFGYITTLFVCAYLYKQTFAIP GSFLLNVIAGVVYDLWSGFILCCCLTTLGSTLCYLFSELFGREYVFYYFGTKLTYLQQKIDDNSNRLLPFLLFARMFPIS PSWLLNIVAPFLNIPLPIFVVSALFGLAPYNFICVQAGYILRDLRSWDDVFSTTTMLKLFSFALIPLAYAIYIRPRAKKH QLVASSSDEEEKPAKMEIV
view sequence (259 aa)
>Cjp-BUS-19
MTRLFILPAIFGISSLSLWWMICSAPGWPESEGGVFEIPKQFDNFTVLAEKFRSYKEDHFGYITTLFVCAYLYKQTFAIP
GSFLLNVIAGVVYDLWSGFILCCCLTTLGSTLCYLFSELFGREYVFYYFGTKLTYLQQKIDDNSNRLLPFLLFARMFPIS
PSWLLNIVAPFLNIPLPIFVVSALFGLAPYNFICVQAGYILRDLRSWDDVFSTTTMLKLFSFALIPLAYAIYIRPRAKKH
QLVASSSDEEEKPAKMEIV
Estimated Isoelectric Point:
6.71486663818359
Estimated Molecular Weight:
29.6 kD
Amino Acid Composition:
Amino Acid Frequency
Thr13
Lys11
Gln6
Leu35
Gly13
Met5
Ser20
Tyr14
His2
Glu11
Arg9
Cys7
Phe25
Pro15
Val14
Asn7
Ala17
Ile20
Trp6
Asp9