Sequence:
download
JA09444sequence.fasta
>Cjp-RNP-3 MADINPNHTIYVNNLNEKIKKEELKRSLHMVFTQFGEVIQLMAFRKEKMRGQAHVVFKEISSASNALRALQGFPFYGKPM RIQYAREDSDAIARAKGTYVEKRLKTTLTKSGAQKKPYDRPANGKVATTAAENGEKKGDRATEEGPGEPNNILFCSAIPE GTDQEQIHVIFNQFPGLREVRWMPNSTEFAFIEYESTEQSEPAREALDNFRITPTHQIKVKFANK
view sequence (225 aa)
>Cjp-RNP-3
MADINPNHTIYVNNLNEKIKKEELKRSLHMVFTQFGEVIQLMAFRKEKMRGQAHVVFKEISSASNALRALQGFPFYGKPM
RIQYAREDSDAIARAKGTYVEKRLKTTLTKSGAQKKPYDRPANGKVATTAAENGEKKGDRATEEGPGEPNNILFCSAIPE
GTDQEQIHVIFNQFPGLREVRWMPNSTEFAFIEYESTEQSEPAREALDNFRITPTHQIKVKFANK
Estimated Isoelectric Point:
9.17580413818359
Estimated Molecular Weight:
25.6 kD
Amino Acid Composition:
Amino Acid Frequency
Thr14
Lys20
Gln11
Leu11
Gly13
Met6
Ser10
Tyr6
His5
Glu22
Arg14
Cys1
Phe13
Pro12
Val10
Asn14
Ala21
Ile14
Trp1
Asp7