Sequence:
download
JA09046sequence.fasta
>Cjp-FOX-1 MQAIYQLTANGAGQHNQQIPIGLSNTLLYQQLAAQQQMAVQQHQQQLAVSAAAHQNQNNIMLATSAPSLINHIENSAENK VKDDPNGDYDLQISIQQQLAAAAAAQAVQIGQNQMGQPQIGPQIVAQGQTAAATAAGPTNGTVAVTQPDPSTSSGPEAPK RLHVSNIPFRFRDPDLKTMFEKFGPVSDVEIIFNERGSKGFGFVTMERPADAERARQELHGSMIEGRKIEVNCATARVHS KKVKPAGGILDPMNPLMAQSALAQAQINRALLLRSPLVAQSLLGRGATLIPGIQQPAAAFQLQAALAANPLAQLQGQPLL FNAAALQSGALQQSAFGMDQAAMQAAALIANEQARLQLAAAAAQGNEYFMYHQAKQQELPGRIPSSGNPAAFGEQYLGNA LSAASLPSYQINPALRTLNRFTPY
view sequence (424 aa)
>Cjp-FOX-1
MQAIYQLTANGAGQHNQQIPIGLSNTLLYQQLAAQQQMAVQQHQQQLAVSAAAHQNQNNIMLATSAPSLINHIENSAENK
VKDDPNGDYDLQISIQQQLAAAAAAQAVQIGQNQMGQPQIGPQIVAQGQTAAATAAGPTNGTVAVTQPDPSTSSGPEAPK
RLHVSNIPFRFRDPDLKTMFEKFGPVSDVEIIFNERGSKGFGFVTMERPADAERARQELHGSMIEGRKIEVNCATARVHS
KKVKPAGGILDPMNPLMAQSALAQAQINRALLLRSPLVAQSLLGRGATLIPGIQQPAAAFQLQAALAANPLAQLQGQPLL
FNAAALQSGALQQSAFGMDQAAMQAAALIANEQARLQLAAAAAQGNEYFMYHQAKQQELPGRIPSSGNPAAFGEQYLGNA
LSAASLPSYQINPALRTLNRFTPY
Estimated Isoelectric Point:
7.88872528076172
Estimated Molecular Weight:
45.0 kD
Amino Acid Composition:
Amino Acid Frequency
Thr15
Lys11
Gln56
Leu40
Gly30
Met12
Ser24
Tyr8
His8
Glu15
Arg16
Cys1
Phe13
Pro28
Val15
Asn25
Ala73
Ile23
Asp11